Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 2653755..2654491 | Replicon | chromosome |
| Accession | NZ_CP099367 | ||
| Organism | Citrobacter portucalensis strain RHB40-E3-C05 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | - |
| Locus tag | NFK63_RS13070 | Protein ID | WP_126318108.1 |
| Coordinates | 2654009..2654491 (+) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | - |
| Locus tag | NFK63_RS13065 | Protein ID | WP_008784769.1 |
| Coordinates | 2653755..2654021 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFK63_RS13045 (2648819) | 2648819..2650006 | + | 1188 | WP_279274735.1 | outer membrane protein transport protein | - |
| NFK63_RS13050 (2650244) | 2650244..2650873 | + | 630 | WP_003832974.1 | winged helix-turn-helix transcriptional regulator | - |
| NFK63_RS13055 (2650990) | 2650990..2651376 | - | 387 | WP_063941972.1 | hypothetical protein | - |
| NFK63_RS13060 (2651619) | 2651619..2653601 | + | 1983 | WP_149335332.1 | alkyl sulfatase dimerization domain-containing protein | - |
| NFK63_RS13065 (2653755) | 2653755..2654021 | + | 267 | WP_008784769.1 | DUF1778 domain-containing protein | Antitoxin |
| NFK63_RS13070 (2654009) | 2654009..2654491 | + | 483 | WP_126318108.1 | GNAT family N-acetyltransferase | Toxin |
| NFK63_RS13075 (2654788) | 2654788..2654919 | - | 132 | Protein_2562 | fatty acid transporter | - |
| NFK63_RS13080 (2654887) | 2654887..2655672 | + | 786 | WP_279274736.1 | DMT family transporter | - |
| NFK63_RS13085 (2655682) | 2655682..2656203 | - | 522 | WP_279275967.1 | GNAT family N-acetyltransferase | - |
| NFK63_RS13090 (2656314) | 2656314..2657072 | + | 759 | WP_126318110.1 | trans-aconitate 2-methyltransferase | - |
| NFK63_RS13095 (2657204) | 2657204..2657581 | + | 378 | WP_003832953.1 | GFA family protein | - |
| NFK63_RS13100 (2657578) | 2657578..2658492 | - | 915 | WP_063941590.1 | bestrophin family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17655.49 Da Isoelectric Point: 9.8994
>T248661 WP_126318108.1 NZ_CP099367:2654009-2654491 [Citrobacter portucalensis]
VGFVTAPEPLTHIHRLAEFVSGEIILDDWLKQKGLKNQALGAARTFVVCKTDTRQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSVRGKGLGADLLHDAVLRCYKVAENIGVRAVMVHALTDEAKRFYLHHGFKASQLQERTLFLRLS
VGFVTAPEPLTHIHRLAEFVSGEIILDDWLKQKGLKNQALGAARTFVVCKTDTRQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSVRGKGLGADLLHDAVLRCYKVAENIGVRAVMVHALTDEAKRFYLHHGFKASQLQERTLFLRLS
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|