Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 837545..838199 | Replicon | chromosome |
| Accession | NZ_CP099367 | ||
| Organism | Citrobacter portucalensis strain RHB40-E3-C05 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | NFK63_RS04145 | Protein ID | WP_003825515.1 |
| Coordinates | 837792..838199 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | - |
| Locus tag | NFK63_RS04140 | Protein ID | WP_003825514.1 |
| Coordinates | 837545..837811 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFK63_RS04115 (832700) | 832700..834133 | - | 1434 | WP_126956613.1 | 6-phospho-beta-glucosidase BglA | - |
| NFK63_RS04120 (834254) | 834254..834982 | - | 729 | WP_279275949.1 | MurR/RpiR family transcriptional regulator | - |
| NFK63_RS04125 (835035) | 835035..835346 | + | 312 | WP_048225466.1 | N(4)-acetylcytidine aminohydrolase | - |
| NFK63_RS04130 (835510) | 835510..836172 | + | 663 | WP_279275505.1 | hemolysin III family protein | - |
| NFK63_RS04135 (836304) | 836304..837287 | - | 984 | WP_126317440.1 | tRNA-modifying protein YgfZ | - |
| NFK63_RS04140 (837545) | 837545..837811 | + | 267 | WP_003825514.1 | FAD assembly factor SdhE | Antitoxin |
| NFK63_RS04145 (837792) | 837792..838199 | + | 408 | WP_003825515.1 | protein YgfX | Toxin |
| NFK63_RS04150 (838301) | 838301..838822 | - | 522 | WP_279275506.1 | flavodoxin FldB | - |
| NFK63_RS04155 (838936) | 838936..839832 | + | 897 | WP_126317441.1 | site-specific tyrosine recombinase XerD | - |
| NFK63_RS04160 (839856) | 839856..840569 | + | 714 | WP_003825520.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| NFK63_RS04165 (840575) | 840575..842308 | + | 1734 | WP_126317443.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15882.76 Da Isoelectric Point: 11.3523
>T248656 WP_003825515.1 NZ_CP099367:837792-838199 [Citrobacter portucalensis]
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWSIVSAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLMLQKAKQG
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWSIVSAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLMLQKAKQG
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|