Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) ykfI-yfjZ/CbtA-CbeA
Location 64692..65371 Replicon chromosome
Accession NZ_CP099367
Organism Citrobacter portucalensis strain RHB40-E3-C05

Toxin (Protein)


Gene name ykfI Uniprot ID -
Locus tag NFK63_RS00325 Protein ID WP_032666240.1
Coordinates 64692..65033 (-) Length 114 a.a.

Antitoxin (Protein)


Gene name yfjZ Uniprot ID -
Locus tag NFK63_RS00330 Protein ID WP_063842515.1
Coordinates 65054..65371 (-) Length 106 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NFK63_RS00295 (61335) 61335..61637 - 303 WP_136391336.1 type II toxin-antitoxin system RelE/ParE family toxin -
NFK63_RS00300 (61641) 61641..61901 - 261 WP_103284557.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
NFK63_RS00305 (62077) 62077..62367 - 291 WP_279275360.1 SymE family type I addiction module toxin -
NFK63_RS00310 (62504) 62504..62698 + 195 WP_003827195.1 toxin-antitoxin system HicB family antitoxin -
NFK63_RS00315 (62707) 62707..63273 - 567 WP_003827197.1 hypothetical protein -
NFK63_RS00320 (63743) 63743..64576 - 834 WP_039026305.1 DUF4942 domain-containing protein -
NFK63_RS00325 (64692) 64692..65033 - 342 WP_032666240.1 TA system toxin CbtA family protein Toxin
NFK63_RS00330 (65054) 65054..65371 - 318 WP_063842515.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
NFK63_RS00335 (65389) 65389..65610 - 222 WP_191215306.1 DUF987 domain-containing protein -
NFK63_RS00340 (65619) 65619..66101 - 483 WP_032250314.1 DNA repair protein RadC -
NFK63_RS00345 (66110) 66110..66571 - 462 WP_016239686.1 antirestriction protein -
NFK63_RS00350 (67204) 67204..67461 - 258 WP_016152751.1 hypothetical protein -
NFK63_RS00355 (67449) 67449..67556 - 108 WP_230330203.1 hypothetical protein -
NFK63_RS00360 (67780) 67780..68688 - 909 WP_016152752.1 SDR family oxidoreductase -
NFK63_RS00365 (69028) 69028..69213 + 186 WP_016152753.1 general stress protein -
NFK63_RS00370 (69306) 69306..69803 + 498 WP_016152754.1 ferritin-like domain-containing protein -
NFK63_RS00375 (69828) 69828..70334 + 507 WP_016152755.1 ferritin-like domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(5-104)


Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 12838.76 Da        Isoelectric Point: 9.9971

>T248655 WP_032666240.1 NZ_CP099367:c65033-64692 [Citrobacter portucalensis]
MKPQSATTSRAAKPCLSPVAVWQMLLTRLLEKHYGLTLNDTPFSDETVIQEHINAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAVDILRARQATGLLRQSRNNAVR

Download         Length: 342 bp

Antitoxin


Download         Length: 106 a.a.        Molecular weight: 11854.36 Da        Isoelectric Point: 6.4612

>AT248655 WP_063842515.1 NZ_CP099367:c65371-65054 [Citrobacter portucalensis]
MSNTTWGLQRDITPRLGARLVQEGNRLHYLADRTSITGKFSDSECRKLDETFPHFISQMESMLTTGELNPQYAHCVTLCH
SGFTCEADTLGSCGYVYIAIYPTQR

Download         Length: 318 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References