Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1(toxin)
Location 4696345..4696961 Replicon chromosome
Accession NZ_CP099366
Organism Citrobacter braakii strain RHB41-E2-C02

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag NFK67_RS22495 Protein ID WP_016155182.1
Coordinates 4696345..4696719 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID R8WIS4
Locus tag NFK67_RS22500 Protein ID WP_016155181.1
Coordinates 4696719..4696961 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NFK67_RS22480 (NFK67_22465) 4693848..4694750 + 903 WP_003028691.1 formate dehydrogenase O subunit beta -
NFK67_RS22485 (NFK67_22470) 4694747..4695382 + 636 WP_279267352.1 formate dehydrogenase cytochrome b556 subunit -
NFK67_RS22490 (NFK67_22475) 4695379..4696308 + 930 WP_003028685.1 formate dehydrogenase accessory protein FdhE -
NFK67_RS22495 (NFK67_22480) 4696345..4696719 - 375 WP_016155182.1 type II toxin-antitoxin system VapC family toxin Toxin
NFK67_RS22500 (NFK67_22485) 4696719..4696961 - 243 WP_016155181.1 CopG family transcriptional regulator Antitoxin
NFK67_RS22505 (NFK67_22490) 4697167..4698087 + 921 WP_279267353.1 alpha/beta hydrolase -
NFK67_RS22510 (NFK67_22495) 4698181..4698492 + 312 WP_279267354.1 type II toxin-antitoxin system HigB family toxin -
NFK67_RS22515 (NFK67_22500) 4698489..4698941 + 453 WP_094761751.1 helix-turn-helix domain-containing protein -
NFK67_RS22520 (NFK67_22505) 4698959..4699900 - 942 WP_003825286.1 fatty acid biosynthesis protein FabY -
NFK67_RS22525 (NFK67_22510) 4699945..4700382 - 438 WP_003028671.1 D-aminoacyl-tRNA deacylase -
NFK67_RS22530 (NFK67_22515) 4700379..4701251 - 873 WP_019077938.1 virulence factor BrkB family protein -
NFK67_RS22535 (NFK67_22520) 4701245..4701844 - 600 WP_016155174.1 glucose-1-phosphatase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(7-113)

Antitoxin

Ribbon-helix-helix protein, CopG

(13-47)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13678.84 Da        Isoelectric Point: 8.5373

>T248653 WP_016155182.1 NZ_CP099366:c4696719-4696345 [Citrobacter braakii]
MVTGSALFDTNILIDLFSGRSEAKLAIETWPPQNAISLITWMELMVGAKKYHQESRTRVALGAFNVIGVSQDIAERSVSI
RQEYGMKLPDAIILATAQIHRLTLVTRNTRDFAGISGVVTPYTL

Download         Length: 375 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9437.72 Da        Isoelectric Point: 4.3331

>AT248653 WP_016155181.1 NZ_CP099366:c4696961-4696719 [Citrobacter braakii]
MMAGMDMGRILLDLSDEVIKRLDDLKVQRNLPRAELLREAVEQYLERQDQAETTISRALGLWQGCEEDGVDYQRKLREEW

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB R8WIS4

References