Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3993884..3994538 | Replicon | chromosome |
Accession | NZ_CP099366 | ||
Organism | Citrobacter braakii strain RHB41-E2-C02 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | R8WN60 |
Locus tag | NFK67_RS19210 | Protein ID | WP_016154348.1 |
Coordinates | 3993884..3994291 (-) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | R8WMJ6 |
Locus tag | NFK67_RS19215 | Protein ID | WP_016154349.1 |
Coordinates | 3994272..3994538 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFK67_RS19190 (NFK67_19185) | 3989776..3991509 | - | 1734 | WP_016157413.1 | single-stranded-DNA-specific exonuclease RecJ | - |
NFK67_RS19195 (NFK67_19190) | 3991515..3992228 | - | 714 | WP_016154345.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NFK67_RS19200 (NFK67_19195) | 3992252..3993148 | - | 897 | WP_016154346.1 | site-specific tyrosine recombinase XerD | - |
NFK67_RS19205 (NFK67_19200) | 3993262..3993783 | + | 522 | WP_016154347.1 | flavodoxin FldB | - |
NFK67_RS19210 (NFK67_19205) | 3993884..3994291 | - | 408 | WP_016154348.1 | protein YgfX | Toxin |
NFK67_RS19215 (NFK67_19210) | 3994272..3994538 | - | 267 | WP_016154349.1 | FAD assembly factor SdhE | Antitoxin |
NFK67_RS19220 (NFK67_19215) | 3994796..3995776 | + | 981 | WP_016154350.1 | tRNA-modifying protein YgfZ | - |
NFK67_RS19225 (NFK67_19220) | 3995856..3996515 | - | 660 | WP_114681073.1 | hemolysin III family protein | - |
NFK67_RS19230 (NFK67_19225) | 3996679..3996990 | - | 312 | WP_279267262.1 | N(4)-acetylcytidine aminohydrolase | - |
NFK67_RS19235 (NFK67_19230) | 3997043..3997771 | + | 729 | WP_075847608.1 | MurR/RpiR family transcriptional regulator | - |
NFK67_RS19240 (NFK67_19235) | 3997892..3999325 | + | 1434 | WP_279267263.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15850.66 Da Isoelectric Point: 11.2845
>T248652 WP_016154348.1 NZ_CP099366:c3994291-3993884 [Citrobacter braakii]
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWTIASAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLILQQAKQG
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWTIASAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLILQQAKQG
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|