Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2496145..2496781 | Replicon | chromosome |
Accession | NZ_CP099366 | ||
Organism | Citrobacter braakii strain RHB41-E2-C02 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | NFK67_RS12040 | Protein ID | WP_137379723.1 |
Coordinates | 2496593..2496781 (-) | Length | 63 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | NFK67_RS12035 | Protein ID | WP_131341011.1 |
Coordinates | 2496145..2496561 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFK67_RS12015 (NFK67_12010) | 2491190..2492134 | - | 945 | WP_016153152.1 | ABC transporter permease | - |
NFK67_RS12020 (NFK67_12015) | 2492135..2493151 | - | 1017 | WP_016156582.1 | ABC transporter ATP-binding protein | - |
NFK67_RS12025 (NFK67_12020) | 2493168..2494313 | - | 1146 | WP_016153154.1 | ABC transporter substrate-binding protein | - |
NFK67_RS12030 (NFK67_12025) | 2494643..2496052 | - | 1410 | WP_019076828.1 | PLP-dependent aminotransferase family protein | - |
NFK67_RS12035 (NFK67_12030) | 2496145..2496561 | - | 417 | WP_131341011.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
NFK67_RS12040 (NFK67_12035) | 2496593..2496781 | - | 189 | WP_137379723.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
NFK67_RS12045 (NFK67_12040) | 2497045..2498448 | + | 1404 | WP_016153156.1 | cytochrome ubiquinol oxidase subunit I | - |
NFK67_RS12050 (NFK67_12045) | 2498448..2499458 | + | 1011 | WP_016153157.1 | cytochrome d ubiquinol oxidase subunit II | - |
NFK67_RS12055 (NFK67_12050) | 2499458..2499583 | + | 126 | WP_003020230.1 | DUF2474 domain-containing protein | - |
NFK67_RS12060 (NFK67_12055) | 2499773..2500003 | + | 231 | WP_016153158.1 | DUF2554 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 63 a.a. Molecular weight: 7175.25 Da Isoelectric Point: 11.8399
>T248651 WP_137379723.1 NZ_CP099366:c2496781-2496593 [Citrobacter braakii]
VKQSEFRRWLESQGVAITNGSNHLKLRYQGRRSVMPRHRGDEIKEALRKSILKQLGLQSSSI
VKQSEFRRWLESQGVAITNGSNHLKLRYQGRRSVMPRHRGDEIKEALRKSILKQLGLQSSSI
Download Length: 189 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15034.31 Da Isoelectric Point: 4.7119
>AT248651 WP_131341011.1 NZ_CP099366:c2496561-2496145 [Citrobacter braakii]
MRYPVNLIPAVEGGFVVSFPDIPEALTQGETRHGALQAAQSALVTAFEFYFDDNEPIPLPSAVGAEGDYVEIPLSIASKV
LLLNAFLESKITQQELANRIGRPKQEITRLFDLKHATKIDAVQIAARALGKELSVTML
MRYPVNLIPAVEGGFVVSFPDIPEALTQGETRHGALQAAQSALVTAFEFYFDDNEPIPLPSAVGAEGDYVEIPLSIASKV
LLLNAFLESKITQQELANRIGRPKQEITRLFDLKHATKIDAVQIAARALGKELSVTML
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|