Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1218948..1219568 | Replicon | chromosome |
Accession | NZ_CP099366 | ||
Organism | Citrobacter braakii strain RHB41-E2-C02 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | NFK67_RS05740 | Protein ID | WP_002892050.1 |
Coordinates | 1218948..1219166 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | A0A7L6U5G9 |
Locus tag | NFK67_RS05745 | Protein ID | WP_019076175.1 |
Coordinates | 1219194..1219568 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFK67_RS05705 (NFK67_05700) | 1214307..1214936 | + | 630 | WP_016155872.1 | membrane protein | - |
NFK67_RS05710 (NFK67_05705) | 1215001..1215354 | + | 354 | WP_003831033.1 | DUF1428 family protein | - |
NFK67_RS05715 (NFK67_05710) | 1215406..1216959 | - | 1554 | WP_279267474.1 | EAL domain-containing protein | - |
NFK67_RS05720 (NFK67_05715) | 1217148..1217408 | + | 261 | WP_016152070.1 | type B 50S ribosomal protein L31 | - |
NFK67_RS05725 (NFK67_05720) | 1217410..1217550 | + | 141 | WP_005125190.1 | type B 50S ribosomal protein L36 | - |
NFK67_RS05730 (NFK67_05725) | 1217629..1218099 | - | 471 | WP_016152071.1 | YlaC family protein | - |
NFK67_RS05735 (NFK67_05730) | 1218216..1218767 | - | 552 | WP_016155874.1 | maltose O-acetyltransferase | - |
NFK67_RS05740 (NFK67_05735) | 1218948..1219166 | - | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
NFK67_RS05745 (NFK67_05740) | 1219194..1219568 | - | 375 | WP_019076175.1 | Hha toxicity modulator TomB | Antitoxin |
NFK67_RS05750 (NFK67_05745) | 1220056..1223205 | - | 3150 | WP_016152073.1 | efflux RND transporter permease AcrB | - |
NFK67_RS05755 (NFK67_05750) | 1223228..1224421 | - | 1194 | WP_279267475.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T248646 WP_002892050.1 NZ_CP099366:c1219166-1218948 [Citrobacter braakii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14413.20 Da Isoelectric Point: 5.5653
>AT248646 WP_019076175.1 NZ_CP099366:c1219568-1219194 [Citrobacter braakii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLVAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLVAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7L6U5G9 |