Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | kacAT/ElaA-DUF1778 |
| Location | 50094..50897 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP099365 | ||
| Organism | Citrobacter braakii strain RHB44-SE-C08 | ||
Toxin (Protein)
| Gene name | KacT | Uniprot ID | W8E895 |
| Locus tag | NFL11_RS24100 | Protein ID | WP_016479963.1 |
| Coordinates | 50094..50624 (-) | Length | 177 a.a. |
Antitoxin (Protein)
| Gene name | KacA | Uniprot ID | W8E6Q5 |
| Locus tag | NFL11_RS24105 | Protein ID | WP_022652312.1 |
| Coordinates | 50628..50897 (-) | Length | 90 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFL11_RS24075 (NFL11_24060) | 46156..47692 | - | 1537 | Protein_54 | IS66 family transposase | - |
| NFL11_RS24080 (NFL11_24065) | 47741..48088 | - | 348 | WP_004092452.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| NFL11_RS24085 (NFL11_24070) | 48085..48486 | - | 402 | WP_004092453.1 | transposase | - |
| NFL11_RS24090 (NFL11_24075) | 48648..48908 | + | 261 | WP_063091378.1 | hypothetical protein | - |
| NFL11_RS24095 (NFL11_24080) | 48905..49891 | + | 987 | WP_279268736.1 | hypothetical protein | - |
| NFL11_RS24100 (NFL11_24085) | 50094..50624 | - | 531 | WP_016479963.1 | GNAT family N-acetyltransferase | Toxin |
| NFL11_RS24105 (NFL11_24090) | 50628..50897 | - | 270 | WP_022652312.1 | DUF1778 domain-containing protein | Antitoxin |
| NFL11_RS24110 (NFL11_24095) | 51231..52136 | + | 906 | WP_032072928.1 | RepB family plasmid replication initiator protein | - |
| NFL11_RS24115 (NFL11_24100) | 52462..53202 | - | 741 | WP_104772627.1 | tyrosine-type recombinase/integrase | - |
| NFL11_RS24125 (NFL11_24110) | 55204..55464 | + | 261 | Protein_64 | IS1 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | ugd | 1..91254 | 91254 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 177 a.a. Molecular weight: 20350.24 Da Isoelectric Point: 6.4907
>T248643 WP_016479963.1 NZ_CP099365:c50624-50094 [Citrobacter braakii]
MEGLRIEIFSEEVEYELSNFDCGEEYLNTFLTDHLKRQHNSKILRGYVLVTREDKPRVMGYYTLSGSCFEKILLPSKTQQ
KRVPYKNVPSVTLGRLAIDKSIHHQGYGETLVTHAMKVVYQASQAVGIHGMFVEALNDNAKKFYLRLGFIQLKEENCNSL
FYPTKSIEELFEVNDE
MEGLRIEIFSEEVEYELSNFDCGEEYLNTFLTDHLKRQHNSKILRGYVLVTREDKPRVMGYYTLSGSCFEKILLPSKTQQ
KRVPYKNVPSVTLGRLAIDKSIHHQGYGETLVTHAMKVVYQASQAVGIHGMFVEALNDNAKKFYLRLGFIQLKEENCNSL
FYPTKSIEELFEVNDE
Download Length: 531 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6C0L7Q2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2Z3XDS5 |