Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 25248..25770 Replicon plasmid unnamed1
Accession NZ_CP099365
Organism Citrobacter braakii strain RHB44-SE-C08

Toxin (Protein)


Gene name relE Uniprot ID G3CAN5
Locus tag NFL11_RS23965 Protein ID WP_000220560.1
Coordinates 25489..25770 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID G3CAG1
Locus tag NFL11_RS23960 Protein ID WP_000121743.1
Coordinates 25248..25499 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NFL11_RS23930 (NFL11_23915) 20717..21094 - 378 WP_239610122.1 tyrosine-type recombinase/integrase -
NFL11_RS23935 (NFL11_23920) 21212..21484 - 273 WP_022652202.1 tyrosine-type recombinase/integrase -
NFL11_RS23940 (NFL11_23925) 21566..22270 + 705 WP_279268754.1 IS6-like element IS26 family transposase -
NFL11_RS23945 (NFL11_23930) 22324..22521 + 198 Protein_28 type II toxin-antitoxin system mRNA interferase RelE -
NFL11_RS23950 (NFL11_23935) 22593..22751 + 159 WP_001447600.1 type I toxin-antitoxin system Hok family toxin -
NFL11_RS23955 (NFL11_23940) 22884..23864 + 981 WP_279268755.1 IS5-like element IS5 family transposase -
NFL11_RS23960 (NFL11_23945) 25248..25499 + 252 WP_000121743.1 plasmid stabilization protein Antitoxin
NFL11_RS23965 (NFL11_23950) 25489..25770 + 282 WP_000220560.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NFL11_RS23970 (NFL11_23955) 25916..26107 + 192 WP_162543439.1 hypothetical protein -
NFL11_RS23975 (NFL11_23960) 26145..27125 - 981 WP_279268755.1 IS5-like element IS5 family transposase -
NFL11_RS23980 (NFL11_23965) 27171..28136 - 966 WP_279268756.1 IS110 family transposase -
NFL11_RS23985 (NFL11_23970) 28471..29493 - 1023 WP_000156884.1 IS110-like element IS5708 family transposase -
NFL11_RS23990 (NFL11_23975) 29578..29952 - 375 Protein_37 Tn3 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - ugd 1..91254 91254
- inside IScluster/Tn - - 9641..32751 23110


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 11005.83 Da        Isoelectric Point: 10.5938

>T248642 WP_000220560.1 NZ_CP099365:25489-25770 [Citrobacter braakii]
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADLR

Download         Length: 282 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9194.43 Da        Isoelectric Point: 4.1683

>AT248642 WP_000121743.1 NZ_CP099365:25248-25499 [Citrobacter braakii]
MSYQILTTTAASITDLKKNPMGTVAEGEGDAVAILNRNEPAFYCVPPKLYAYYRELAEDAELNAVADERMKNPEIVKVNL
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G3CAN5

Antitoxin

Source ID Structure
AlphaFold DB A0A3S5I301

References