Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-DnaT |
| Location | 4280861..4281380 | Replicon | chromosome |
| Accession | NZ_CP099364 | ||
| Organism | Citrobacter braakii strain RHB44-SE-C08 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A8I0G602 |
| Locus tag | NFL11_RS20930 | Protein ID | WP_047414720.1 |
| Coordinates | 4280861..4281142 (-) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | NFL11_RS20935 | Protein ID | WP_049270661.1 |
| Coordinates | 4281132..4281380 (-) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFL11_RS20915 (4277863) | 4277863..4278327 | + | 465 | WP_016155562.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| NFL11_RS20920 (4278349) | 4278349..4278870 | - | 522 | WP_019078246.1 | hypothetical protein | - |
| NFL11_RS20925 (4278870) | 4278870..4280834 | - | 1965 | WP_109017766.1 | type VI secretion system tip protein TssI/VgrG | - |
| NFL11_RS20930 (4280861) | 4280861..4281142 | - | 282 | WP_047414720.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NFL11_RS20935 (4281132) | 4281132..4281380 | - | 249 | WP_049270661.1 | plasmid stabilization protein | Antitoxin |
| NFL11_RS20940 (4281478) | 4281478..4281606 | - | 129 | WP_256372910.1 | hypothetical protein | - |
| NFL11_RS20945 (4281675) | 4281675..4282148 | - | 474 | WP_016155556.1 | hypothetical protein | - |
| NFL11_RS20950 (4282191) | 4282191..4284692 | - | 2502 | WP_279268279.1 | type VI secretion system ATPase TssH | - |
| NFL11_RS20955 (4284683) | 4284683..4285630 | - | 948 | WP_279268280.1 | type VI secretion system baseplate subunit TssG | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10974.73 Da Isoelectric Point: 10.4466
>T248639 WP_047414720.1 NZ_CP099364:c4281142-4280861 [Citrobacter braakii]
MTYNLEFLDVALKEWRKLSPALREQFKKKLAERLENPHVPAARLSGKLHRYKIKLRSAGYRLVYQVEDEQVVVLVIAVGR
RDGDEVYHQANRR
MTYNLEFLDVALKEWRKLSPALREQFKKKLAERLENPHVPAARLSGKLHRYKIKLRSAGYRLVYQVEDEQVVVLVIAVGR
RDGDEVYHQANRR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|