Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
| Location | 4190101..4190677 | Replicon | chromosome |
| Accession | NZ_CP099364 | ||
| Organism | Citrobacter braakii strain RHB44-SE-C08 | ||
Toxin (Protein)
| Gene name | shpA | Uniprot ID | A0A7L6U8Z2 |
| Locus tag | NFL11_RS20520 | Protein ID | WP_049040418.1 |
| Coordinates | 4190390..4190677 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | shpB | Uniprot ID | A0A2I8S1U6 |
| Locus tag | NFL11_RS20515 | Protein ID | WP_016155614.1 |
| Coordinates | 4190101..4190403 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFL11_RS20500 (4186596) | 4186596..4186790 | + | 195 | WP_003830038.1 | YbdD/YjiX family protein | - |
| NFL11_RS20505 (4186803) | 4186803..4187759 | + | 957 | WP_016155616.1 | GTPase | - |
| NFL11_RS20510 (4187946) | 4187946..4189793 | + | 1848 | WP_101700343.1 | 3'-5' exonuclease | - |
| NFL11_RS20515 (4190101) | 4190101..4190403 | - | 303 | WP_016155614.1 | BrnA antitoxin family protein | Antitoxin |
| NFL11_RS20520 (4190390) | 4190390..4190677 | - | 288 | WP_049040418.1 | BrnT family toxin | Toxin |
| NFL11_RS20525 (4190911) | 4190911..4192077 | + | 1167 | WP_019078303.1 | restriction endonuclease | - |
| NFL11_RS20530 (4192173) | 4192173..4192319 | + | 147 | Protein_4022 | type I restriction endonuclease subunit R | - |
| NFL11_RS20535 (4192306) | 4192306..4192566 | + | 261 | Protein_4023 | endoribonuclease SymE | - |
| NFL11_RS20540 (4192661) | 4192661..4193152 | - | 492 | WP_016151575.1 | type VI secretion system tube protein TssD | - |
| NFL11_RS20545 (4193153) | 4193153..4193659 | - | 507 | WP_016155610.1 | hypothetical protein | - |
| NFL11_RS20550 (4193659) | 4193659..4194090 | - | 432 | WP_225836832.1 | DUF2778 domain-containing protein | - |
| NFL11_RS20555 (4194248) | 4194248..4194418 | - | 171 | Protein_4027 | hypothetical protein | - |
| NFL11_RS20560 (4194424) | 4194424..4194878 | - | 455 | Protein_4028 | MarR family transcriptional regulator | - |
| NFL11_RS20565 (4195027) | 4195027..4195191 | - | 165 | WP_016155606.1 | DUF1127 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11293.68 Da Isoelectric Point: 7.5237
>T248638 WP_049040418.1 NZ_CP099364:c4190677-4190390 [Citrobacter braakii]
MPMEFEWDANKAQSNHRKHGVRFEDAILVFDDPQHLSRQDRYENGEYRWQTIGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERSRYEHS
MPMEFEWDANKAQSNHRKHGVRFEDAILVFDDPQHLSRQDRYENGEYRWQTIGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERSRYEHS
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7L6U8Z2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2I8S1U6 |