Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2358609..2359245 | Replicon | chromosome |
Accession | NZ_CP099364 | ||
Organism | Citrobacter braakii strain RHB44-SE-C08 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A2I8S6E9 |
Locus tag | NFL11_RS11580 | Protein ID | WP_049259794.1 |
Coordinates | 2358609..2358797 (+) | Length | 63 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | NFL11_RS11585 | Protein ID | WP_146053235.1 |
Coordinates | 2358829..2359245 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFL11_RS11560 (2355387) | 2355387..2355617 | - | 231 | WP_279268720.1 | DUF2554 family protein | - |
NFL11_RS11565 (2355807) | 2355807..2355932 | - | 126 | WP_003020230.1 | DUF2474 domain-containing protein | - |
NFL11_RS11570 (2355932) | 2355932..2356942 | - | 1011 | WP_016153157.1 | cytochrome d ubiquinol oxidase subunit II | - |
NFL11_RS11575 (2356942) | 2356942..2358345 | - | 1404 | WP_016153156.1 | cytochrome ubiquinol oxidase subunit I | - |
NFL11_RS11580 (2358609) | 2358609..2358797 | + | 189 | WP_049259794.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
NFL11_RS11585 (2358829) | 2358829..2359245 | + | 417 | WP_146053235.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
NFL11_RS11590 (2359338) | 2359338..2360747 | + | 1410 | WP_103283798.1 | PLP-dependent aminotransferase family protein | - |
NFL11_RS11595 (2361077) | 2361077..2362222 | + | 1146 | WP_016153154.1 | ABC transporter substrate-binding protein | - |
NFL11_RS11600 (2362239) | 2362239..2363255 | + | 1017 | WP_016156582.1 | ABC transporter ATP-binding protein | - |
NFL11_RS11605 (2363256) | 2363256..2364200 | + | 945 | WP_016153152.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 63 a.a. Molecular weight: 7102.16 Da Isoelectric Point: 11.5775
>T248632 WP_049259794.1 NZ_CP099364:2358609-2358797 [Citrobacter braakii]
VKQSEFRRWLESQGVAVTNGSNHLKLRYQGRRSVMPRHPGDEIKEALRKSILKQLGLQSSSI
VKQSEFRRWLESQGVAVTNGSNHLKLRYQGRRSVMPRHPGDEIKEALRKSILKQLGLQSSSI
Download Length: 189 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15080.33 Da Isoelectric Point: 4.7119
>AT248632 WP_146053235.1 NZ_CP099364:2358829-2359245 [Citrobacter braakii]
MRYPVNLIPSVEGGFVVSFPDIPEALTQGETRHGALQAAQSALVTAFEFYFDDNEPIPLPSAVGTEGDYVEIPLSIASKV
LLLNAFLESKITQQELANRIGRPKQEITRLFDLKHATKIDAVQIAARALGKELSVTML
MRYPVNLIPSVEGGFVVSFPDIPEALTQGETRHGALQAAQSALVTAFEFYFDDNEPIPLPSAVGTEGDYVEIPLSIASKV
LLLNAFLESKITQQELANRIGRPKQEITRLFDLKHATKIDAVQIAARALGKELSVTML
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|