Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
| Location | 695836..696515 | Replicon | chromosome |
| Accession | NZ_CP099364 | ||
| Organism | Citrobacter braakii strain RHB44-SE-C08 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | - |
| Locus tag | NFL11_RS03470 | Protein ID | WP_097724914.1 |
| Coordinates | 696174..696515 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | R8WMM2 |
| Locus tag | NFL11_RS03465 | Protein ID | WP_006812013.1 |
| Coordinates | 695836..696153 (+) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFL11_RS03420 (691275) | 691275..692093 | + | 819 | WP_096996569.1 | DUF932 domain-containing protein | - |
| NFL11_RS03425 (692310) | 692310..693011 | + | 702 | WP_001548933.1 | WYL domain-containing protein | - |
| NFL11_RS03430 (693052) | 693052..693288 | + | 237 | WP_001144031.1 | protein YpjK | - |
| NFL11_RS03435 (693288) | 693288..693731 | + | 444 | WP_001547764.1 | lipoprotein YafY | - |
| NFL11_RS03440 (693755) | 693755..694222 | + | 468 | WP_001547765.1 | protein YkfB | - |
| NFL11_RS03445 (694299) | 694299..694538 | + | 240 | WP_000194654.1 | DUF905 family protein | - |
| NFL11_RS03450 (694636) | 694636..695094 | + | 459 | WP_000211838.1 | antirestriction protein | - |
| NFL11_RS03455 (695110) | 695110..695586 | + | 477 | WP_000811693.1 | RadC family protein | - |
| NFL11_RS03460 (695595) | 695595..695816 | + | 222 | WP_000691995.1 | DUF987 domain-containing protein | - |
| NFL11_RS03465 (695836) | 695836..696153 | + | 318 | WP_006812013.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NFL11_RS03470 (696174) | 696174..696515 | + | 342 | WP_097724914.1 | TA system toxin CbtA family protein | Toxin |
| NFL11_RS03475 (696631) | 696631..697464 | + | 834 | WP_046495848.1 | DUF4942 domain-containing protein | - |
| NFL11_RS03485 (697768) | 697768..698274 | + | 507 | WP_016157505.1 | G/U mismatch-specific DNA glycosylase | - |
| NFL11_RS03490 (698320) | 698320..700164 | - | 1845 | WP_016154549.1 | RNA polymerase sigma factor RpoD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 652328..696515 | 44187 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12959.00 Da Isoelectric Point: 10.2764
>T248630 WP_097724914.1 NZ_CP099364:696174-696515 [Citrobacter braakii]
MKTLPATTQRAAKPCLAPVAVWQMLLTRLLKQHYGLTLNDTPFSEERVIQEHIDAGITLADAVNFLVEKYELVRIDRKGF
NWQEQSPYLRAADILRARQATGLLRQSRNNVVR
MKTLPATTQRAAKPCLAPVAVWQMLLTRLLKQHYGLTLNDTPFSEERVIQEHIDAGITLADAVNFLVEKYELVRIDRKGF
NWQEQSPYLRAADILRARQATGLLRQSRNNVVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|