Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
| Location | 57041..57720 | Replicon | chromosome |
| Accession | NZ_CP099364 | ||
| Organism | Citrobacter braakii strain RHB44-SE-C08 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | - |
| Locus tag | NFL11_RS00290 | Protein ID | WP_279268341.1 |
| Coordinates | 57041..57382 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | - |
| Locus tag | NFL11_RS00295 | Protein ID | WP_279268342.1 |
| Coordinates | 57403..57720 (-) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFL11_RS00265 (52263) | 52263..53243 | + | 981 | WP_000019403.1 | IS5-like element IS5 family transposase | - |
| NFL11_RS00270 (53281) | 53281..53967 | - | 687 | WP_279268338.1 | AIPR family protein | - |
| NFL11_RS00280 (54808) | 54808..55335 | - | 528 | WP_279268339.1 | hypothetical protein | - |
| NFL11_RS00285 (56047) | 56047..56748 | + | 702 | WP_279268340.1 | toll/interleukin-1 receptor domain-containing protein | - |
| NFL11_RS00290 (57041) | 57041..57382 | - | 342 | WP_279268341.1 | TA system toxin CbtA family protein | Toxin |
| NFL11_RS00295 (57403) | 57403..57720 | - | 318 | WP_279268342.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NFL11_RS00300 (57739) | 57739..57960 | - | 222 | WP_279268343.1 | DUF987 domain-containing protein | - |
| NFL11_RS00305 (57969) | 57969..58445 | - | 477 | WP_279268344.1 | RadC family protein | - |
| NFL11_RS00310 (58461) | 58461..58793 | - | 333 | Protein_61 | antirestriction protein | - |
| NFL11_RS00315 (58744) | 58744..60555 | - | 1812 | WP_279268733.1 | AIDA repeat-containing protein | - |
| NFL11_RS00320 (60618) | 60618..61301 | - | 684 | WP_279268345.1 | WYL domain-containing protein | - |
| NFL11_RS00325 (61529) | 61529..62356 | - | 828 | WP_279268346.1 | DUF932 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12759.65 Da Isoelectric Point: 8.9789
>T248629 WP_279268341.1 NZ_CP099364:c57382-57041 [Citrobacter braakii]
MKSLPATTSRTAKSCLSPVAVWQMLLTRLLEKHYGLTLNDTPFSDETVIQEHIDAGITLADAINFLVEKYELVRIDRKGF
SWQEQSPYLRAVDILRARQATGLLRQSRNNAVG
MKSLPATTSRTAKSCLSPVAVWQMLLTRLLEKHYGLTLNDTPFSDETVIQEHIDAGITLADAINFLVEKYELVRIDRKGF
SWQEQSPYLRAVDILRARQATGLLRQSRNNAVG
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|