Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
| Location | 67079..67680 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP099360 | ||
| Organism | Escherichia fergusonii strain RHB02-E1-C03 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | U9YA20 |
| Locus tag | NFJ18_RS23810 | Protein ID | WP_001216045.1 |
| Coordinates | 67079..67459 (-) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | - |
| Locus tag | NFJ18_RS23815 | Protein ID | WP_181465529.1 |
| Coordinates | 67459..67680 (-) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFJ18_RS23780 (NFJ18_23740) | 62179..62298 | - | 120 | WP_071594056.1 | ash family protein | - |
| NFJ18_RS23785 (NFJ18_23745) | 62520..63962 | - | 1443 | WP_236522756.1 | terminase | - |
| NFJ18_RS23790 (NFJ18_23750) | 64004..65197 | - | 1194 | WP_096321055.1 | terminase | - |
| NFJ18_RS23795 (NFJ18_23755) | 65283..65735 | - | 453 | WP_001326849.1 | late promoter-activating protein | - |
| NFJ18_RS23800 (NFJ18_23760) | 65824..66867 | - | 1044 | WP_069187067.1 | DUF968 domain-containing protein | - |
| NFJ18_RS23805 (NFJ18_23765) | 66895..67074 | - | 180 | WP_001339207.1 | hypothetical protein | - |
| NFJ18_RS23810 (NFJ18_23770) | 67079..67459 | - | 381 | WP_001216045.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| NFJ18_RS23815 (NFJ18_23775) | 67459..67680 | - | 222 | WP_181465529.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
| NFJ18_RS23820 (NFJ18_23780) | 67863..69419 | + | 1557 | WP_181465530.1 | type I restriction-modification system subunit M | - |
| NFJ18_RS23825 (NFJ18_23785) | 69416..70696 | + | 1281 | WP_113449347.1 | restriction endonuclease subunit S | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..94718 | 94718 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13588.29 Da Isoelectric Point: 5.1514
>T248628 WP_001216045.1 NZ_CP099360:c67459-67079 [Escherichia fergusonii]
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|