Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
| Location | 3815317..3815893 | Replicon | chromosome |
| Accession | NZ_CP099358 | ||
| Organism | Escherichia fergusonii strain RHB02-E1-C03 | ||
Toxin (Protein)
| Gene name | shpA | Uniprot ID | A0A7W3EF74 |
| Locus tag | NFJ18_RS18490 | Protein ID | WP_024256534.1 |
| Coordinates | 3815606..3815893 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | shpB | Uniprot ID | A0A829G8Z0 |
| Locus tag | NFJ18_RS18485 | Protein ID | WP_000063156.1 |
| Coordinates | 3815317..3815619 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFJ18_RS18465 (3811131) | 3811131..3811643 | + | 513 | WP_001175455.1 | 4-hydroxyphenylacetate 3-monooxygenase reductase subunit | - |
| NFJ18_RS18470 (3811913) | 3811913..3814063 | + | 2151 | WP_001314407.1 | pyruvate/proton symporter BtsT | - |
| NFJ18_RS18475 (3814113) | 3814113..3814316 | + | 204 | WP_000467859.1 | YbdD/YjiX family protein | - |
| NFJ18_RS18480 (3814327) | 3814327..3815283 | + | 957 | WP_001355122.1 | GTPase | - |
| NFJ18_RS18485 (3815317) | 3815317..3815619 | - | 303 | WP_000063156.1 | BrnA antitoxin family protein | Antitoxin |
| NFJ18_RS18490 (3815606) | 3815606..3815893 | - | 288 | WP_024256534.1 | BrnT family toxin | Toxin |
| NFJ18_RS18495 (3816049) | 3816049..3816783 | - | 735 | WP_000208601.1 | Fic family protein | - |
| NFJ18_RS18500 (3817046) | 3817046..3820558 | + | 3513 | WP_181202857.1 | type I restriction-modification system endonuclease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11241.74 Da Isoelectric Point: 7.4020
>T248619 WP_024256534.1 NZ_CP099358:c3815893-3815606 [Escherichia fergusonii]
MPMEFEWDANKAKSNRMKHGIRFEDAVLVFDDPQHLSQQDRIENGEYRWQTIGLVYGIVVILVAHTIRFESGNEIIRIIS
ARKADRKERNRYEHG
MPMEFEWDANKAKSNRMKHGIRFEDAVLVFDDPQHLSQQDRIENGEYRWQTIGLVYGIVVILVAHTIRFESGNEIIRIIS
ARKADRKERNRYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7W3EF74 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829G8Z0 |