Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 3559728..3560382 | Replicon | chromosome |
| Accession | NZ_CP099358 | ||
| Organism | Escherichia fergusonii strain RHB02-E1-C03 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1PAM6 |
| Locus tag | NFJ18_RS17260 | Protein ID | WP_000244781.1 |
| Coordinates | 3559728..3560135 (-) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | NFJ18_RS17265 | Protein ID | WP_000354046.1 |
| Coordinates | 3560116..3560382 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFJ18_RS17240 (3555685) | 3555685..3557418 | - | 1734 | WP_000813234.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| NFJ18_RS17245 (3557424) | 3557424..3558134 | - | 711 | WP_104917537.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| NFJ18_RS17250 (3558159) | 3558159..3559055 | - | 897 | WP_000806645.1 | site-specific tyrosine recombinase XerD | - |
| NFJ18_RS17255 (3559167) | 3559167..3559688 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
| NFJ18_RS17260 (3559728) | 3559728..3560135 | - | 408 | WP_000244781.1 | protein YgfX | Toxin |
| NFJ18_RS17265 (3560116) | 3560116..3560382 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| NFJ18_RS17270 (3560634) | 3560634..3561614 | + | 981 | WP_181202810.1 | tRNA-modifying protein YgfZ | - |
| NFJ18_RS17275 (3561691) | 3561691..3562350 | - | 660 | WP_000250283.1 | hemolysin III family protein | - |
| NFJ18_RS17280 (3562514) | 3562514..3562825 | - | 312 | WP_001182952.1 | N(4)-acetylcytidine aminohydrolase | - |
| NFJ18_RS17285 (3562870) | 3562870..3564303 | + | 1434 | WP_148047390.1 | 6-phospho-beta-glucosidase BglA | - |
| NFJ18_RS17290 (3564351) | 3564351..3565244 | - | 894 | WP_000819362.1 | transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T248618 WP_000244781.1 NZ_CP099358:c3560135-3559728 [Escherichia fergusonii]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|