Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3292820..3293439 | Replicon | chromosome |
Accession | NZ_CP099358 | ||
Organism | Escherichia fergusonii strain RHB02-E1-C03 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | NFJ18_RS16035 | Protein ID | WP_001280991.1 |
Coordinates | 3293221..3293439 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | B7LLQ9 |
Locus tag | NFJ18_RS16030 | Protein ID | WP_000344803.1 |
Coordinates | 3292820..3293194 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFJ18_RS16020 (3287952) | 3287952..3289145 | + | 1194 | WP_002431407.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NFJ18_RS16025 (3289168) | 3289168..3292317 | + | 3150 | WP_001132493.1 | efflux RND transporter permease AcrB | - |
NFJ18_RS16030 (3292820) | 3292820..3293194 | + | 375 | WP_000344803.1 | Hha toxicity modulator TomB | Antitoxin |
NFJ18_RS16035 (3293221) | 3293221..3293439 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
NFJ18_RS16040 (3293934) | 3293934..3294404 | + | 471 | WP_002431406.1 | YlaC family protein | - |
NFJ18_RS16045 (3294543) | 3294543..3296093 | + | 1551 | WP_181202748.1 | EAL domain-containing protein | - |
NFJ18_RS16050 (3296135) | 3296135..3296488 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
NFJ18_RS16060 (3296867) | 3296867..3297178 | + | 312 | WP_000409907.1 | MGMT family protein | - |
NFJ18_RS16065 (3297209) | 3297209..3297781 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T248617 WP_001280991.1 NZ_CP099358:3293221-3293439 [Escherichia fergusonii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14525.33 Da Isoelectric Point: 4.8989
>AT248617 WP_000344803.1 NZ_CP099358:3292820-3293194 [Escherichia fergusonii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|