Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1303754..1304379 | Replicon | chromosome |
Accession | NZ_CP099358 | ||
Organism | Escherichia fergusonii strain RHB02-E1-C03 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | U9YZ02 |
Locus tag | NFJ18_RS06315 | Protein ID | WP_000911329.1 |
Coordinates | 1303981..1304379 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | NFJ18_RS06310 | Protein ID | WP_000450524.1 |
Coordinates | 1303754..1303981 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFJ18_RS06285 (1299556) | 1299556..1300026 | - | 471 | WP_001068688.1 | thioredoxin-dependent thiol peroxidase | - |
NFJ18_RS06290 (1300026) | 1300026..1300598 | - | 573 | WP_000189057.1 | glycine cleavage system transcriptional repressor | - |
NFJ18_RS06295 (1300745) | 1300745..1301623 | + | 879 | WP_000494011.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
NFJ18_RS06300 (1301640) | 1301640..1302674 | + | 1035 | WP_002431657.1 | outer membrane protein assembly factor BamC | - |
NFJ18_RS06305 (1302886) | 1302886..1303599 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
NFJ18_RS06310 (1303754) | 1303754..1303981 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
NFJ18_RS06315 (1303981) | 1303981..1304379 | + | 399 | WP_000911329.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NFJ18_RS06320 (1304526) | 1304526..1305389 | + | 864 | WP_001267498.1 | neutral zinc metallopeptidase | - |
NFJ18_RS06325 (1305404) | 1305404..1307419 | + | 2016 | WP_181203253.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
NFJ18_RS06330 (1307493) | 1307493..1308194 | + | 702 | WP_105288162.1 | esterase | - |
NFJ18_RS06335 (1308289) | 1308289..1308489 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14924.23 Da Isoelectric Point: 8.5325
>T248610 WP_000911329.1 NZ_CP099358:1303981-1304379 [Escherichia fergusonii]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XW84 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CM33 |