Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 393225..393747 | Replicon | chromosome |
Accession | NZ_CP099358 | ||
Organism | Escherichia fergusonii strain RHB02-E1-C03 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A7W3EN85 |
Locus tag | NFJ18_RS01880 | Protein ID | WP_046083069.1 |
Coordinates | 393457..393747 (+) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | B7LMQ7 |
Locus tag | NFJ18_RS01875 | Protein ID | WP_000212726.1 |
Coordinates | 393225..393467 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFJ18_RS01855 (389074) | 389074..390447 | + | 1374 | WP_001219809.1 | UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl- meso-diaminopimelate ligase | - |
NFJ18_RS01860 (390598) | 390598..391149 | - | 552 | WP_000166277.1 | ribosome biogenesis factor YjgA | - |
NFJ18_RS01865 (391243) | 391243..392595 | + | 1353 | WP_001162171.1 | metalloprotease PmbA | - |
NFJ18_RS01870 (392648) | 392648..393034 | + | 387 | WP_001232246.1 | cytochrome b562 | - |
NFJ18_RS01875 (393225) | 393225..393467 | + | 243 | WP_000212726.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
NFJ18_RS01880 (393457) | 393457..393747 | + | 291 | WP_046083069.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NFJ18_RS01885 (393748) | 393748..394212 | - | 465 | WP_001106232.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
NFJ18_RS01890 (394370) | 394370..396508 | - | 2139 | WP_000187805.1 | anaerobic ribonucleoside-triphosphate reductase | - |
NFJ18_RS01895 (396902) | 396902..398557 | - | 1656 | WP_181203089.1 | alpha,alpha-phosphotrehalase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11323.22 Da Isoelectric Point: 10.3007
>T248605 WP_046083069.1 NZ_CP099358:393457-393747 [Escherichia fergusonii]
MNYELAFDPRALKEWQKLGVTVREQFKKKLGDVLKRPRNPSAKLRDLPDCYKIKLRTLGYRRVYQVNDKELLVLVIAIGK
RENSAVYEDATKRLDE
MNYELAFDPRALKEWQKLGVTVREQFKKKLGDVLKRPRNPSAKLRDLPDCYKIKLRTLGYRRVYQVNDKELLVLVIAIGK
RENSAVYEDATKRLDE
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7W3EN85 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7W3HXN7 |