Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
| Location | 65603..66204 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP099352 | ||
| Organism | Escherichia marmotae strain RHB02-E4-C07 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | V0AJ64 |
| Locus tag | NFJ26_RS22115 | Protein ID | WP_001216034.1 |
| Coordinates | 65824..66204 (+) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | U9YQH9 |
| Locus tag | NFJ26_RS22110 | Protein ID | WP_001190712.1 |
| Coordinates | 65603..65824 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFJ26_RS22100 (NFJ26_22005) | 62632..63867 | - | 1236 | WP_032175094.1 | restriction endonuclease subunit S | - |
| NFJ26_RS22105 (NFJ26_22010) | 63864..65420 | - | 1557 | WP_001568002.1 | type I restriction-modification system subunit M | - |
| NFJ26_RS22110 (NFJ26_22015) | 65603..65824 | + | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| NFJ26_RS22115 (NFJ26_22020) | 65824..66204 | + | 381 | WP_001216034.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| NFJ26_RS22120 (NFJ26_22025) | 66209..66388 | + | 180 | WP_001446091.1 | hypothetical protein | - |
| NFJ26_RS22125 (NFJ26_22030) | 66416..67459 | + | 1044 | WP_000648817.1 | DUF968 domain-containing protein | - |
| NFJ26_RS22130 (NFJ26_22035) | 67548..68000 | + | 453 | WP_062871772.1 | hypothetical protein | - |
| NFJ26_RS22135 (NFJ26_22040) | 68086..69279 | + | 1194 | WP_016240561.1 | hypothetical protein | - |
| NFJ26_RS22140 (NFJ26_22045) | 69321..70763 | + | 1443 | WP_227453992.1 | terminase | - |
| NFJ26_RS22145 (NFJ26_22050) | 70977..71078 | + | 102 | Protein_77 | transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | - | 1..116771 | 116771 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13615.32 Da Isoelectric Point: 5.1514
>T248604 WP_001216034.1 NZ_CP099352:65824-66204 [Escherichia marmotae]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V0AJ64 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CJB6 |