Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3606087..3606738 | Replicon | chromosome |
Accession | NZ_CP099351 | ||
Organism | Escherichia marmotae strain RHB02-E4-C07 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A370V2T3 |
Locus tag | NFJ26_RS17160 | Protein ID | WP_000244789.1 |
Coordinates | 3606087..3606491 (-) | Length | 135 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | A0A7U9H610 |
Locus tag | NFJ26_RS17165 | Protein ID | WP_000354045.1 |
Coordinates | 3606472..3606738 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFJ26_RS17140 (3602051) | 3602051..3603784 | - | 1734 | WP_000813173.1 | single-stranded-DNA-specific exonuclease RecJ | - |
NFJ26_RS17145 (3603790) | 3603790..3604500 | - | 711 | WP_000715232.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NFJ26_RS17150 (3604525) | 3604525..3605421 | - | 897 | WP_000806649.1 | site-specific tyrosine recombinase XerD | - |
NFJ26_RS17155 (3605532) | 3605532..3606053 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
NFJ26_RS17160 (3606087) | 3606087..3606491 | - | 405 | WP_000244789.1 | protein YgfX | Toxin |
NFJ26_RS17165 (3606472) | 3606472..3606738 | - | 267 | WP_000354045.1 | FAD assembly factor SdhE | Antitoxin |
NFJ26_RS17170 (3606991) | 3606991..3607971 | + | 981 | WP_000886070.1 | tRNA-modifying protein YgfZ | - |
NFJ26_RS17175 (3608118) | 3608118..3608777 | - | 660 | WP_000250293.1 | hemolysin III family protein | - |
NFJ26_RS17180 (3608940) | 3608940..3609251 | - | 312 | WP_001182960.1 | N(4)-acetylcytidine aminohydrolase | - |
NFJ26_RS17185 (3609296) | 3609296..3610729 | + | 1434 | WP_010378607.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 15987.93 Da Isoelectric Point: 11.5202
>T248603 WP_000244789.1 NZ_CP099351:c3606491-3606087 [Escherichia marmotae]
VVLWQSELRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWLVLLSLVVFDCVRSQRRINSRQGEIRLLMDGRLRWQGQ
EWSIVKTPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQEIR
VVLWQSELRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWLVLLSLVVFDCVRSQRRINSRQGEIRLLMDGRLRWQGQ
EWSIVKTPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQEIR
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A370V2T3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9H610 |