Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2323052..2323690 | Replicon | chromosome |
| Accession | NZ_CP099351 | ||
| Organism | Escherichia marmotae strain RHB02-E4-C07 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A7U9DHD1 |
| Locus tag | NFJ26_RS10960 | Protein ID | WP_000813795.1 |
| Coordinates | 2323514..2323690 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NFJ26_RS10955 | Protein ID | WP_077627724.1 |
| Coordinates | 2323052..2323468 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFJ26_RS10935 (2318207) | 2318207..2319148 | - | 942 | WP_001251301.1 | ABC transporter permease | - |
| NFJ26_RS10940 (2319149) | 2319149..2320162 | - | 1014 | WP_000220424.1 | ABC transporter ATP-binding protein | - |
| NFJ26_RS10945 (2320180) | 2320180..2321325 | - | 1146 | WP_000047463.1 | ABC transporter substrate-binding protein | - |
| NFJ26_RS10950 (2321564) | 2321564..2322973 | - | 1410 | WP_000760662.1 | PLP-dependent aminotransferase family protein | - |
| NFJ26_RS10955 (2323052) | 2323052..2323468 | - | 417 | WP_077627724.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| NFJ26_RS10960 (2323514) | 2323514..2323690 | - | 177 | WP_000813795.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| NFJ26_RS10965 (2323912) | 2323912..2324142 | + | 231 | WP_000494240.1 | DUF2554 family protein | - |
| NFJ26_RS10970 (2324236) | 2324236..2326197 | - | 1962 | WP_010376311.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| NFJ26_RS10975 (2326270) | 2326270..2326806 | - | 537 | WP_000429073.1 | XRE family transcriptional regulator | - |
| NFJ26_RS10980 (2326898) | 2326898..2328070 | + | 1173 | WP_001236306.1 | benzoate/H(+) symporter BenE family transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6747.80 Da Isoelectric Point: 11.5666
>T248601 WP_000813795.1 NZ_CP099351:c2323690-2323514 [Escherichia marmotae]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPSEEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPSEEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15250.62 Da Isoelectric Point: 4.5908
>AT248601 WP_077627724.1 NZ_CP099351:c2323468-2323052 [Escherichia marmotae]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNNNDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNNNDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|