Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1146986..1147604 | Replicon | chromosome |
Accession | NZ_CP099351 | ||
Organism | Escherichia marmotae strain RHB02-E4-C07 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | NFJ26_RS05345 | Protein ID | WP_001280991.1 |
Coordinates | 1146986..1147204 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | A0A7U9DNY0 |
Locus tag | NFJ26_RS05350 | Protein ID | WP_000344801.1 |
Coordinates | 1147209..1147604 (-) | Length | 132 a.a. |
Genomic Context
Location: 1142280..1142852 (573 bp)
Type: Others
Protein ID: WP_000779817.1
Type: Others
Protein ID: WP_000779817.1
Location: 1143574..1143927 (354 bp)
Type: Others
Protein ID: WP_000878149.1
Type: Others
Protein ID: WP_000878149.1
Location: 1142883..1143194 (312 bp)
Type: Others
Protein ID: WP_000409903.1
Type: Others
Protein ID: WP_000409903.1
Location: 1143964..1145514 (1551 bp)
Type: Others
Protein ID: WP_001515896.1
Type: Others
Protein ID: WP_001515896.1
Location: 1145678..1146148 (471 bp)
Type: Others
Protein ID: WP_010379081.1
Type: Others
Protein ID: WP_010379081.1
Location: 1146263..1146814 (552 bp)
Type: Others
Protein ID: WP_000102537.1
Type: Others
Protein ID: WP_000102537.1
Location: 1146986..1147204 (219 bp)
Type: Toxin
Protein ID: WP_001280991.1
Type: Toxin
Protein ID: WP_001280991.1
Location: 1147209..1147604 (396 bp)
Type: Antitoxin
Protein ID: WP_000344801.1
Type: Antitoxin
Protein ID: WP_000344801.1
Location: 1148161..1151310 (3150 bp)
Type: Others
Protein ID: WP_001132495.1
Type: Others
Protein ID: WP_001132495.1
Location: 1151333..1152526 (1194 bp)
Type: Others
Protein ID: WP_001515899.1
Type: Others
Protein ID: WP_001515899.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFJ26_RS05310 (1142280) | 1142280..1142852 | + | 573 | WP_000779817.1 | YbaY family lipoprotein | - |
NFJ26_RS05315 (1142883) | 1142883..1143194 | - | 312 | WP_000409903.1 | MGMT family protein | - |
NFJ26_RS05325 (1143574) | 1143574..1143927 | + | 354 | WP_000878149.1 | DUF1428 domain-containing protein | - |
NFJ26_RS05330 (1143964) | 1143964..1145514 | - | 1551 | WP_001515896.1 | EAL domain-containing protein | - |
NFJ26_RS05335 (1145678) | 1145678..1146148 | - | 471 | WP_010379081.1 | YlaC family protein | - |
NFJ26_RS05340 (1146263) | 1146263..1146814 | - | 552 | WP_000102537.1 | maltose O-acetyltransferase | - |
NFJ26_RS05345 (1146986) | 1146986..1147204 | - | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
NFJ26_RS05350 (1147209) | 1147209..1147604 | - | 396 | WP_000344801.1 | Hha toxicity modulator TomB | Antitoxin |
NFJ26_RS05355 (1148161) | 1148161..1151310 | - | 3150 | WP_001132495.1 | efflux RND transporter permease AcrB | - |
NFJ26_RS05360 (1151333) | 1151333..1152526 | - | 1194 | WP_001515899.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T248594 WP_001280991.1 NZ_CP099351:c1147204-1146986 [Escherichia marmotae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 15393.22 Da Isoelectric Point: 4.9228
>AT248594 WP_000344801.1 NZ_CP099351:c1147604-1147209 [Escherichia marmotae]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSCSNYYNHG
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSCSNYYNHG
Download Length: 396 bp
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
PDB | 4ICG |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9DNY0 |