Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
| Location | 605055..605631 | Replicon | chromosome |
| Accession | NZ_CP099351 | ||
| Organism | Escherichia marmotae strain RHB02-E4-C07 | ||
Toxin (Protein)
| Gene name | shpA | Uniprot ID | - |
| Locus tag | NFJ26_RS02780 | Protein ID | WP_105270768.1 |
| Coordinates | 605055..605342 (+) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | shpB | Uniprot ID | A0A7U9DAW4 |
| Locus tag | NFJ26_RS02785 | Protein ID | WP_000063150.1 |
| Coordinates | 605329..605631 (+) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFJ26_RS02765 (600658) | 600658..602019 | - | 1362 | WP_000535394.1 | restriction endonuclease subunit S | - |
| NFJ26_RS02770 (602009) | 602009..603628 | - | 1620 | WP_001029742.1 | class I SAM-dependent DNA methyltransferase | - |
| NFJ26_RS02775 (603692) | 603692..604858 | - | 1167 | WP_000800829.1 | restriction endonuclease | - |
| NFJ26_RS02780 (605055) | 605055..605342 | + | 288 | WP_105270768.1 | BrnT family toxin | Toxin |
| NFJ26_RS02785 (605329) | 605329..605631 | + | 303 | WP_000063150.1 | BrnA antitoxin family protein | Antitoxin |
| NFJ26_RS02790 (605665) | 605665..606621 | - | 957 | WP_001297640.1 | GTPase | - |
| NFJ26_RS02795 (606632) | 606632..606835 | - | 204 | WP_000467859.1 | YbdD/YjiX family protein | - |
| NFJ26_RS02800 (606967) | 606967..609117 | - | 2151 | WP_061091154.1 | pyruvate/proton symporter BtsT | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11110.64 Da Isoelectric Point: 8.6424
>T248592 WP_105270768.1 NZ_CP099351:605055-605342 [Escherichia marmotae]
MPMEFEWDANKVKSNRVKHGIRFEDAVLVFDDPQHLSQQDRVGNGEYRWQTIGLVHGIVVILVAHIIRFESGNEIIRIIS
ARKADRKERSRYEHG
MPMEFEWDANKVKSNRVKHGIRFEDAVLVFDDPQHLSQQDRVGNGEYRWQTIGLVHGIVVILVAHIIRFESGNEIIRIIS
ARKADRKERSRYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|