Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 250949..251471 Replicon plasmid unnamed1
Accession NZ_CP099350
Organism Escherichia fergusonii strain RHB16-E2-C07

Toxin (Protein)


Gene name relE Uniprot ID D0QMR1
Locus tag NFJ86_RS23470 Protein ID WP_000220561.1
Coordinates 251190..251471 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID G3CAG1
Locus tag NFJ86_RS23465 Protein ID WP_000121743.1
Coordinates 250949..251200 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NFJ86_RS23445 (NFJ86_23405) 246090..248480 - 2391 WP_000694550.1 Ig-like domain-containing protein -
NFJ86_RS23450 (NFJ86_23410) 248553..248720 - 168 WP_000803860.1 hypothetical protein -
NFJ86_RS23455 (NFJ86_23415) 249041..249223 + 183 WP_042634467.1 hypothetical protein -
NFJ86_RS23460 (NFJ86_23420) 249257..249961 - 705 WP_001067858.1 IS6-like element IS26 family transposase -
NFJ86_RS23465 (NFJ86_23425) 250949..251200 + 252 WP_000121743.1 plasmid stabilization protein Antitoxin
NFJ86_RS23470 (NFJ86_23430) 251190..251471 + 282 WP_000220561.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NFJ86_RS23475 (NFJ86_23435) 251710..251802 - 93 Protein_272 IS6 family transposase -
NFJ86_RS23480 (NFJ86_23440) 251968..253167 - 1200 WP_051124567.1 IS91 family transposase -
NFJ86_RS23485 (NFJ86_23445) 253177..253365 - 189 WP_000957857.1 hypothetical protein -
NFJ86_RS23490 (NFJ86_23450) 253485..254915 + 1431 Protein_275 IS4-like element IS50R family transposase -
NFJ86_RS23495 (NFJ86_23455) 254944..255738 + 795 WP_000572405.1 aminoglycoside O-phosphotransferase APH(3')-IIa -
NFJ86_RS23500 (NFJ86_23460) 255759..255995 + 237 Protein_277 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid aph(6)-Id / aph(3'')-Ib / tet(B) / blaTEM-1B / aph(3')-Ia / aac(3)-IVa / aph(4)-Ia / sul3 / ant(3'')-Ia / cmlA1 / aadA2 / tet(A) / dfrA12 / qacE / sul1 / aph(3')-IIa - 1..277375 277375


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 11023.86 Da        Isoelectric Point: 10.5938

>T248590 WP_000220561.1 NZ_CP099350:251190-251471 [Escherichia fergusonii]
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADMR

Download         Length: 282 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9194.43 Da        Isoelectric Point: 4.1683

>AT248590 WP_000121743.1 NZ_CP099350:250949-251200 [Escherichia fergusonii]
MSYQILTTTAASITDLKKNPMGTVAEGEGDAVAILNRNEPAFYCVPPKLYAYYRELAEDAELNAVADERMKNPEIVKVNL
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3S5I302

Antitoxin

Source ID Structure
AlphaFold DB A0A3S5I301

References