Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-DnaT |
| Location | 250949..251471 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP099350 | ||
| Organism | Escherichia fergusonii strain RHB16-E2-C07 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | D0QMR1 |
| Locus tag | NFJ86_RS23470 | Protein ID | WP_000220561.1 |
| Coordinates | 251190..251471 (+) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | G3CAG1 |
| Locus tag | NFJ86_RS23465 | Protein ID | WP_000121743.1 |
| Coordinates | 250949..251200 (+) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFJ86_RS23445 (NFJ86_23405) | 246090..248480 | - | 2391 | WP_000694550.1 | Ig-like domain-containing protein | - |
| NFJ86_RS23450 (NFJ86_23410) | 248553..248720 | - | 168 | WP_000803860.1 | hypothetical protein | - |
| NFJ86_RS23455 (NFJ86_23415) | 249041..249223 | + | 183 | WP_042634467.1 | hypothetical protein | - |
| NFJ86_RS23460 (NFJ86_23420) | 249257..249961 | - | 705 | WP_001067858.1 | IS6-like element IS26 family transposase | - |
| NFJ86_RS23465 (NFJ86_23425) | 250949..251200 | + | 252 | WP_000121743.1 | plasmid stabilization protein | Antitoxin |
| NFJ86_RS23470 (NFJ86_23430) | 251190..251471 | + | 282 | WP_000220561.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NFJ86_RS23475 (NFJ86_23435) | 251710..251802 | - | 93 | Protein_272 | IS6 family transposase | - |
| NFJ86_RS23480 (NFJ86_23440) | 251968..253167 | - | 1200 | WP_051124567.1 | IS91 family transposase | - |
| NFJ86_RS23485 (NFJ86_23445) | 253177..253365 | - | 189 | WP_000957857.1 | hypothetical protein | - |
| NFJ86_RS23490 (NFJ86_23450) | 253485..254915 | + | 1431 | Protein_275 | IS4-like element IS50R family transposase | - |
| NFJ86_RS23495 (NFJ86_23455) | 254944..255738 | + | 795 | WP_000572405.1 | aminoglycoside O-phosphotransferase APH(3')-IIa | - |
| NFJ86_RS23500 (NFJ86_23460) | 255759..255995 | + | 237 | Protein_277 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | aph(6)-Id / aph(3'')-Ib / tet(B) / blaTEM-1B / aph(3')-Ia / aac(3)-IVa / aph(4)-Ia / sul3 / ant(3'')-Ia / cmlA1 / aadA2 / tet(A) / dfrA12 / qacE / sul1 / aph(3')-IIa | - | 1..277375 | 277375 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 11023.86 Da Isoelectric Point: 10.5938
>T248590 WP_000220561.1 NZ_CP099350:251190-251471 [Escherichia fergusonii]
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADMR
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADMR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3S5I302 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3S5I301 |