Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 4234352..4234977 | Replicon | chromosome |
| Accession | NZ_CP099349 | ||
| Organism | Escherichia fergusonii strain RHB16-E2-C07 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | U9YZ02 |
| Locus tag | NFJ86_RS20375 | Protein ID | WP_000911329.1 |
| Coordinates | 4234579..4234977 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | U9XQV3 |
| Locus tag | NFJ86_RS20370 | Protein ID | WP_000450524.1 |
| Coordinates | 4234352..4234579 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFJ86_RS20345 (4230154) | 4230154..4230624 | - | 471 | WP_001068688.1 | thioredoxin-dependent thiol peroxidase | - |
| NFJ86_RS20350 (4230624) | 4230624..4231196 | - | 573 | WP_000189057.1 | glycine cleavage system transcriptional repressor | - |
| NFJ86_RS20355 (4231343) | 4231343..4232221 | + | 879 | WP_000494011.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
| NFJ86_RS20360 (4232238) | 4232238..4233272 | + | 1035 | WP_002431657.1 | outer membrane protein assembly factor BamC | - |
| NFJ86_RS20365 (4233484) | 4233484..4234197 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| NFJ86_RS20370 (4234352) | 4234352..4234579 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| NFJ86_RS20375 (4234579) | 4234579..4234977 | + | 399 | WP_000911329.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NFJ86_RS20380 (4235124) | 4235124..4235987 | + | 864 | WP_001267498.1 | neutral zinc metallopeptidase | - |
| NFJ86_RS20385 (4236002) | 4236002..4238017 | + | 2016 | WP_181203253.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
| NFJ86_RS20390 (4238091) | 4238091..4238792 | + | 702 | WP_105288162.1 | esterase | - |
| NFJ86_RS20395 (4238887) | 4238887..4239087 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14924.23 Da Isoelectric Point: 8.5325
>T248588 WP_000911329.1 NZ_CP099349:4234579-4234977 [Escherichia fergusonii]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XW84 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CM33 |