Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 3394032..3394554 | Replicon | chromosome |
Accession | NZ_CP099349 | ||
Organism | Escherichia fergusonii strain RHB16-E2-C07 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A7W3EN85 |
Locus tag | NFJ86_RS16400 | Protein ID | WP_046083069.1 |
Coordinates | 3394264..3394554 (+) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | B7LMQ7 |
Locus tag | NFJ86_RS16395 | Protein ID | WP_000212726.1 |
Coordinates | 3394032..3394274 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFJ86_RS16375 (3389881) | 3389881..3391254 | + | 1374 | WP_001219809.1 | UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl- meso-diaminopimelate ligase | - |
NFJ86_RS16380 (3391405) | 3391405..3391956 | - | 552 | WP_000166277.1 | ribosome biogenesis factor YjgA | - |
NFJ86_RS16385 (3392050) | 3392050..3393402 | + | 1353 | WP_001162171.1 | metalloprotease PmbA | - |
NFJ86_RS16390 (3393455) | 3393455..3393841 | + | 387 | WP_001232246.1 | cytochrome b562 | - |
NFJ86_RS16395 (3394032) | 3394032..3394274 | + | 243 | WP_000212726.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
NFJ86_RS16400 (3394264) | 3394264..3394554 | + | 291 | WP_046083069.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NFJ86_RS16405 (3394555) | 3394555..3395019 | - | 465 | WP_001106232.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
NFJ86_RS16410 (3395177) | 3395177..3397315 | - | 2139 | WP_000187805.1 | anaerobic ribonucleoside-triphosphate reductase | - |
NFJ86_RS16415 (3397709) | 3397709..3399364 | - | 1656 | WP_181203089.1 | alpha,alpha-phosphotrehalase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11323.22 Da Isoelectric Point: 10.3007
>T248583 WP_046083069.1 NZ_CP099349:3394264-3394554 [Escherichia fergusonii]
MNYELAFDPRALKEWQKLGVTVREQFKKKLGDVLKRPRNPSAKLRDLPDCYKIKLRTLGYRRVYQVNDKELLVLVIAIGK
RENSAVYEDATKRLDE
MNYELAFDPRALKEWQKLGVTVREQFKKKLGDVLKRPRNPSAKLRDLPDCYKIKLRTLGYRRVYQVNDKELLVLVIAIGK
RENSAVYEDATKRLDE
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7W3EN85 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7W3HXN7 |