Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 1867367..1868021 | Replicon | chromosome |
Accession | NZ_CP099349 | ||
Organism | Escherichia fergusonii strain RHB16-E2-C07 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1PAM6 |
Locus tag | NFJ86_RS09205 | Protein ID | WP_000244781.1 |
Coordinates | 1867367..1867774 (-) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | NFJ86_RS09210 | Protein ID | WP_000354046.1 |
Coordinates | 1867755..1868021 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFJ86_RS09185 (1863324) | 1863324..1865057 | - | 1734 | WP_000813234.1 | single-stranded-DNA-specific exonuclease RecJ | - |
NFJ86_RS09190 (1865063) | 1865063..1865773 | - | 711 | WP_104917537.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NFJ86_RS09195 (1865798) | 1865798..1866694 | - | 897 | WP_000806645.1 | site-specific tyrosine recombinase XerD | - |
NFJ86_RS09200 (1866806) | 1866806..1867327 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
NFJ86_RS09205 (1867367) | 1867367..1867774 | - | 408 | WP_000244781.1 | protein YgfX | Toxin |
NFJ86_RS09210 (1867755) | 1867755..1868021 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
NFJ86_RS09215 (1868273) | 1868273..1869253 | + | 981 | WP_181202810.1 | tRNA-modifying protein YgfZ | - |
NFJ86_RS09220 (1869330) | 1869330..1869989 | - | 660 | WP_000250283.1 | hemolysin III family protein | - |
NFJ86_RS09225 (1870153) | 1870153..1870464 | - | 312 | WP_001182952.1 | N(4)-acetylcytidine aminohydrolase | - |
NFJ86_RS09230 (1870509) | 1870509..1871942 | + | 1434 | WP_148047390.1 | 6-phospho-beta-glucosidase BglA | - |
NFJ86_RS09235 (1871990) | 1871990..1872883 | - | 894 | WP_000819362.1 | transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T248578 WP_000244781.1 NZ_CP099349:c1867774-1867367 [Escherichia fergusonii]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|