Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1588246..1588865 | Replicon | chromosome |
Accession | NZ_CP099349 | ||
Organism | Escherichia fergusonii strain RHB16-E2-C07 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | NFJ86_RS07805 | Protein ID | WP_001280991.1 |
Coordinates | 1588647..1588865 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | B7LLQ9 |
Locus tag | NFJ86_RS07800 | Protein ID | WP_000344803.1 |
Coordinates | 1588246..1588620 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFJ86_RS07790 (1583378) | 1583378..1584571 | + | 1194 | WP_002431407.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NFJ86_RS07795 (1584594) | 1584594..1587743 | + | 3150 | WP_001132493.1 | efflux RND transporter permease AcrB | - |
NFJ86_RS07800 (1588246) | 1588246..1588620 | + | 375 | WP_000344803.1 | Hha toxicity modulator TomB | Antitoxin |
NFJ86_RS07805 (1588647) | 1588647..1588865 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
NFJ86_RS07810 (1589360) | 1589360..1589830 | + | 471 | WP_002431406.1 | YlaC family protein | - |
NFJ86_RS07815 (1589969) | 1589969..1591519 | + | 1551 | WP_181202748.1 | EAL domain-containing protein | - |
NFJ86_RS07820 (1591561) | 1591561..1591914 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
NFJ86_RS07830 (1592293) | 1592293..1592604 | + | 312 | WP_000409907.1 | MGMT family protein | - |
NFJ86_RS07835 (1592635) | 1592635..1593207 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T248577 WP_001280991.1 NZ_CP099349:1588647-1588865 [Escherichia fergusonii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14525.33 Da Isoelectric Point: 4.8989
>AT248577 WP_000344803.1 NZ_CP099349:1588246-1588620 [Escherichia fergusonii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|