Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 84163..84788 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP099345 | ||
| Organism | Escherichia marmotae strain RHB35-E2-C08 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | NFK54_RS24155 | Protein ID | WP_000911306.1 |
| Coordinates | 84163..84561 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | D6IDB0 |
| Locus tag | NFK54_RS24160 | Protein ID | WP_000450523.1 |
| Coordinates | 84561..84788 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFK54_RS24135 (81359) | 81359..82006 | + | 648 | WP_097456829.1 | hypothetical protein | - |
| NFK54_RS24140 (82078) | 82078..82815 | + | 738 | WP_000926075.1 | conjugal transfer complement resistance protein TraT | - |
| NFK54_RS24145 (82943) | 82943..83506 | + | 564 | WP_279283671.1 | hypothetical protein | - |
| NFK54_RS24150 (83778) | 83778..84146 | + | 369 | WP_245146932.1 | DUF2726 domain-containing protein | - |
| NFK54_RS24155 (84163) | 84163..84561 | - | 399 | WP_000911306.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NFK54_RS24160 (84561) | 84561..84788 | - | 228 | WP_000450523.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| NFK54_RS24165 (84921) | 84921..87107 | + | 2187 | WP_000099426.1 | type IV conjugative transfer system coupling protein TraD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | pefD | 1..98156 | 98156 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14958.31 Da Isoelectric Point: 8.1432
>T248566 WP_000911306.1 NZ_CP099345:c84561-84163 [Escherichia marmotae]
MLKFMLDTNICIFTIKNKPAHIRERFNLNSGRMCISSVTVMELVYGAEKSQFPERNLAIIEGFISRLDVLDYDCAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERIAGLRLEDWC
MLKFMLDTNICIFTIKNKPAHIRERFNLNSGRMCISSVTVMELVYGAEKSQFPERNLAIIEGFISRLDVLDYDCAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERIAGLRLEDWC
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|