Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4312150..4312768 | Replicon | chromosome |
Accession | NZ_CP099344 | ||
Organism | Escherichia marmotae strain RHB35-E2-C08 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | NFK54_RS20925 | Protein ID | WP_001280991.1 |
Coordinates | 4312150..4312368 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | A0A7U9DNY0 |
Locus tag | NFK54_RS20930 | Protein ID | WP_000344801.1 |
Coordinates | 4312373..4312768 (-) | Length | 132 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFK54_RS20890 (4307444) | 4307444..4308016 | + | 573 | WP_000779815.1 | YbaY family lipoprotein | - |
NFK54_RS20895 (4308047) | 4308047..4308358 | - | 312 | WP_000409903.1 | MGMT family protein | - |
NFK54_RS20905 (4308738) | 4308738..4309091 | + | 354 | WP_000878149.1 | DUF1428 domain-containing protein | - |
NFK54_RS20910 (4309128) | 4309128..4310678 | - | 1551 | WP_115775484.1 | EAL domain-containing protein | - |
NFK54_RS20915 (4310842) | 4310842..4311312 | - | 471 | WP_001515897.1 | YlaC family protein | - |
NFK54_RS20920 (4311427) | 4311427..4311978 | - | 552 | WP_000102537.1 | maltose O-acetyltransferase | - |
NFK54_RS20925 (4312150) | 4312150..4312368 | - | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
NFK54_RS20930 (4312373) | 4312373..4312768 | - | 396 | WP_000344801.1 | Hha toxicity modulator TomB | Antitoxin |
NFK54_RS20935 (4313325) | 4313325..4316474 | - | 3150 | WP_001132495.1 | efflux RND transporter permease AcrB | - |
NFK54_RS20940 (4316497) | 4316497..4317690 | - | 1194 | WP_001515899.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T248562 WP_001280991.1 NZ_CP099344:c4312368-4312150 [Escherichia marmotae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 15393.22 Da Isoelectric Point: 4.9228
>AT248562 WP_000344801.1 NZ_CP099344:c4312768-4312373 [Escherichia marmotae]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSCSNYYNHG
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSCSNYYNHG
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|