Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3420010..3420845 | Replicon | chromosome |
| Accession | NZ_CP099344 | ||
| Organism | Escherichia marmotae strain RHB35-E2-C08 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | NFK54_RS16700 | Protein ID | WP_279283212.1 |
| Coordinates | 3420010..3420387 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A839BA76 |
| Locus tag | NFK54_RS16705 | Protein ID | WP_024180636.1 |
| Coordinates | 3420477..3420845 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFK54_RS16680 (3415219) | 3415219..3415320 | - | 102 | Protein_3254 | DUF4942 domain-containing protein | - |
| NFK54_RS16685 (3415628) | 3415628..3418741 | - | 3114 | WP_279283211.1 | autotransporter outer membrane beta-barrel domain-containing protein | - |
| NFK54_RS16690 (3419591) | 3419591..3419788 | - | 198 | WP_279283654.1 | hypothetical protein | - |
| NFK54_RS16695 (3419816) | 3419816..3420013 | - | 198 | Protein_3257 | DUF5983 family protein | - |
| NFK54_RS16700 (3420010) | 3420010..3420387 | - | 378 | WP_279283212.1 | TA system toxin CbtA family protein | Toxin |
| NFK54_RS16705 (3420477) | 3420477..3420845 | - | 369 | WP_024180636.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NFK54_RS16710 (3420924) | 3420924..3421145 | - | 222 | WP_000692300.1 | DUF987 domain-containing protein | - |
| NFK54_RS16715 (3421214) | 3421214..3421690 | - | 477 | WP_001186711.1 | RadC family protein | - |
| NFK54_RS16720 (3421706) | 3421706..3422191 | - | 486 | WP_000206667.1 | antirestriction protein | - |
| NFK54_RS16725 (3422283) | 3422283..3423101 | - | 819 | WP_001234700.1 | DUF932 domain-containing protein | - |
| NFK54_RS16730 (3423192) | 3423192..3423425 | - | 234 | WP_001278282.1 | DUF905 family protein | - |
| NFK54_RS16735 (3423431) | 3423431..3424108 | - | 678 | WP_001097414.1 | hypothetical protein | - |
| NFK54_RS16740 (3424227) | 3424227..3425111 | - | 885 | WP_279283213.1 | 50S ribosome-binding GTPase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 3403476..3429890 | 26414 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14249.30 Da Isoelectric Point: 8.2905
>T248560 WP_279283212.1 NZ_CP099344:c3420387-3420010 [Escherichia marmotae]
MKTLPDTHIREASRCPSPVTVWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEVKR
MKTLPDTHIREASRCPSPVTVWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEVKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13614.32 Da Isoelectric Point: 6.3147
>AT248560 WP_024180636.1 NZ_CP099344:c3420845-3420477 [Escherichia marmotae]
VSDTLPGTTHPDNNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTFGSCGYVYLAVYPTPETKT
VSDTLPGTTHPDNNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTFGSCGYVYLAVYPTPETKT
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|