Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 2113531..2114359 Replicon chromosome
Accession NZ_CP099344
Organism Escherichia marmotae strain RHB35-E2-C08

Toxin (Protein)


Gene name yeeV Uniprot ID -
Locus tag NFK54_RS10495 Protein ID WP_001560291.1
Coordinates 2113985..2114359 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID -
Locus tag NFK54_RS10490 Protein ID WP_279283649.1
Coordinates 2113531..2113896 (+) Length 122 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NFK54_RS10450 (2108682) 2108682..2109044 + 363 Protein_2049 hypothetical protein -
NFK54_RS10460 (2110308) 2110308..2110631 + 324 Protein_2051 hypothetical protein -
NFK54_RS10465 (2110647) 2110647..2111057 + 411 WP_000846713.1 hypothetical protein -
NFK54_RS10470 (2111278) 2111278..2112099 + 822 WP_279283610.1 DUF932 domain-containing protein -
NFK54_RS10475 (2112190) 2112190..2112675 + 486 WP_085449263.1 antirestriction protein -
NFK54_RS10480 (2112691) 2112691..2113167 + 477 WP_001560293.1 RadC family protein -
NFK54_RS10485 (2113236) 2113236..2113457 + 222 WP_279283611.1 DUF987 domain-containing protein -
NFK54_RS10490 (2113531) 2113531..2113896 + 366 WP_279283649.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
NFK54_RS10495 (2113985) 2113985..2114359 + 375 WP_001560291.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
NFK54_RS10500 (2114356) 2114356..2114509 + 154 Protein_2059 DUF5983 family protein -
NFK54_RS10505 (2114585) 2114585..2114782 + 198 WP_122984277.1 DUF957 domain-containing protein -
NFK54_RS10510 (2114867) 2114867..2115424 + 558 Protein_2061 DUF4942 domain-containing protein -
NFK54_RS10515 (2115722) 2115722..2117107 - 1386 WP_105268009.1 VasL domain-containing protein -
NFK54_RS10520 (2117222) 2117222..2117674 - 453 WP_105268010.1 type VI secretion system baseplate subunit TssE -
NFK54_RS10525 (2117667) 2117667..2118203 - 537 WP_193487713.1 type VI secretion system lipoprotein TssJ -
NFK54_RS10530 (2118184) 2118184..2119287 - 1104 WP_105268012.1 type VI secretion system baseplate subunit TssG -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(17-116)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.00 Da        Isoelectric Point: 7.8522

>T248558 WP_001560291.1 NZ_CP099344:2113985-2114359 [Escherichia marmotae]
MKTLPVLPGQAASSRPSPVEIWQILLTRLLDQHYGLTLNDTPFADERVIELHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 122 a.a.        Molecular weight: 13525.31 Da        Isoelectric Point: 6.8411

>AT248558 WP_279283649.1 NZ_CP099344:2113531-2113896 [Escherichia marmotae]
VSDTLPGTTHPDNNNRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSGE
LSPRYQHTVTLYAKGLTCEADTFGSCGYVYLAVYPTPETKK

Download         Length: 366 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References