Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 1976682..1977333 | Replicon | chromosome |
| Accession | NZ_CP099344 | ||
| Organism | Escherichia marmotae strain RHB35-E2-C08 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A370V2T3 |
| Locus tag | NFK54_RS09805 | Protein ID | WP_000244789.1 |
| Coordinates | 1976682..1977086 (-) | Length | 135 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | A0A7U9H610 |
| Locus tag | NFK54_RS09810 | Protein ID | WP_000354045.1 |
| Coordinates | 1977067..1977333 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFK54_RS09785 (1972646) | 1972646..1974379 | - | 1734 | WP_279283594.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| NFK54_RS09790 (1974385) | 1974385..1975095 | - | 711 | WP_000715232.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| NFK54_RS09795 (1975120) | 1975120..1976016 | - | 897 | WP_000806649.1 | site-specific tyrosine recombinase XerD | - |
| NFK54_RS09800 (1976127) | 1976127..1976648 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
| NFK54_RS09805 (1976682) | 1976682..1977086 | - | 405 | WP_000244789.1 | protein YgfX | Toxin |
| NFK54_RS09810 (1977067) | 1977067..1977333 | - | 267 | WP_000354045.1 | FAD assembly factor SdhE | Antitoxin |
| NFK54_RS09815 (1977586) | 1977586..1978566 | + | 981 | WP_000886070.1 | tRNA-modifying protein YgfZ | - |
| NFK54_RS09820 (1978713) | 1978713..1979372 | - | 660 | WP_001517030.1 | hemolysin III family protein | - |
| NFK54_RS09825 (1979535) | 1979535..1979846 | - | 312 | WP_001182960.1 | N(4)-acetylcytidine aminohydrolase | - |
| NFK54_RS09830 (1979891) | 1979891..1981324 | + | 1434 | WP_279283595.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 15987.93 Da Isoelectric Point: 11.5202
>T248557 WP_000244789.1 NZ_CP099344:c1977086-1976682 [Escherichia marmotae]
VVLWQSELRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWLVLLSLVVFDCVRSQRRINSRQGEIRLLMDGRLRWQGQ
EWSIVKTPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQEIR
VVLWQSELRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWLVLLSLVVFDCVRSQRRINSRQGEIRLLMDGRLRWQGQ
EWSIVKTPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQEIR
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A370V2T3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9H610 |