Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 668138..668776 | Replicon | chromosome |
Accession | NZ_CP099344 | ||
Organism | Escherichia marmotae strain RHB35-E2-C08 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A7U9DHD1 |
Locus tag | NFK54_RS03420 | Protein ID | WP_000813795.1 |
Coordinates | 668600..668776 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | NFK54_RS03415 | Protein ID | WP_077627724.1 |
Coordinates | 668138..668554 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFK54_RS03395 (663293) | 663293..664234 | - | 942 | WP_279283435.1 | ABC transporter permease | - |
NFK54_RS03400 (664235) | 664235..665248 | - | 1014 | WP_016248715.1 | ABC transporter ATP-binding protein | - |
NFK54_RS03405 (665266) | 665266..666411 | - | 1146 | WP_000047463.1 | ABC transporter substrate-binding protein | - |
NFK54_RS03410 (666650) | 666650..668059 | - | 1410 | WP_107179918.1 | PLP-dependent aminotransferase family protein | - |
NFK54_RS03415 (668138) | 668138..668554 | - | 417 | WP_077627724.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
NFK54_RS03420 (668600) | 668600..668776 | - | 177 | WP_000813795.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
NFK54_RS03425 (668998) | 668998..669228 | + | 231 | WP_000494240.1 | DUF2554 family protein | - |
NFK54_RS03430 (669322) | 669322..671283 | - | 1962 | WP_279283640.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
NFK54_RS03435 (671356) | 671356..671892 | - | 537 | WP_000429073.1 | XRE family transcriptional regulator | - |
NFK54_RS03440 (671984) | 671984..673156 | + | 1173 | WP_024191882.1 | benzoate/H(+) symporter BenE family transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6747.80 Da Isoelectric Point: 11.5666
>T248555 WP_000813795.1 NZ_CP099344:c668776-668600 [Escherichia marmotae]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPSEEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPSEEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15250.62 Da Isoelectric Point: 4.5908
>AT248555 WP_077627724.1 NZ_CP099344:c668554-668138 [Escherichia marmotae]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNNNDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNNNDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|