Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 23059..23584 Replicon plasmid unnamed4
Accession NZ_CP099342
Organism Escherichia fergusonii strain RHB44-C01

Toxin (Protein)


Gene name ccdB Uniprot ID F0JY91
Locus tag NFK94_RS23515 Protein ID WP_001159869.1
Coordinates 23279..23584 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID H9TJP1
Locus tag NFK94_RS23510 Protein ID WP_000813630.1
Coordinates 23059..23277 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NFK94_RS23485 (NFK94_23455) 18747..18897 - 151 Protein_17 hypothetical protein -
NFK94_RS23490 (NFK94_23460) 18850..19080 - 231 WP_252990174.1 IS66 family insertion sequence element accessory protein TnpB -
NFK94_RS23495 (NFK94_23465) 19958..20608 + 651 Protein_19 transposase -
NFK94_RS23500 (NFK94_23470) 20886..21482 - 597 Protein_20 IS66 family transposase -
NFK94_RS23505 (NFK94_23475) 21572..22000 - 429 Protein_21 hypothetical protein -
NFK94_RS23510 (NFK94_23480) 23059..23277 + 219 WP_000813630.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
NFK94_RS23515 (NFK94_23485) 23279..23584 + 306 WP_001159869.1 type II toxin-antitoxin system toxin CcdB Toxin
NFK94_RS23520 (NFK94_23490) 23585..23785 + 201 Protein_24 phage integrase family protein -
NFK94_RS23525 (NFK94_23495) 23770..24681 - 912 WP_000549737.1 DMT family transporter -
NFK94_RS23530 (NFK94_23500) 24798..24935 + 138 Protein_26 Lrp/AsnC family transcriptional regulator -
NFK94_RS23535 (NFK94_23505) 24935..25984 + 1050 Protein_27 IS4 family transposase -
NFK94_RS23540 (NFK94_23510) 26084..27457 - 1374 WP_279279891.1 IS4-like element ISEc13 family transposase -
NFK94_RS23545 (NFK94_23515) 27669..28103 - 435 WP_000525034.1 IS200/IS605 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - - 1..45944 45944
- inside IScluster/Tn - - 17899..28103 10204


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11678.46 Da        Isoelectric Point: 6.4674

>T248548 WP_001159869.1 NZ_CP099342:23279-23584 [Escherichia fergusonii]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTSDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8354.27 Da        Isoelectric Point: 4.5203

>AT248548 WP_000813630.1 NZ_CP099342:23059-23277 [Escherichia fergusonii]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTLQNEARRLRAERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3V2SIB9

Antitoxin

Source ID Structure
AlphaFold DB A0A829CEF5

References