Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapB(antitoxin)
Location 4606..5180 Replicon plasmid unnamed3
Accession NZ_CP099341
Organism Escherichia fergusonii strain RHB44-C01

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag NFK94_RS22935 Protein ID WP_279279884.1
Coordinates 4806..5180 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag NFK94_RS22930 Protein ID WP_279279883.1
Coordinates 4606..4809 (+) Length 68 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NFK94_RS22900 (1) 1..858 + 858 WP_000130961.1 incFII family plasmid replication initiator RepA -
NFK94_RS22905 (1769) 1769..2053 + 285 WP_279279880.1 ribbon-helix-helix domain-containing protein -
NFK94_RS22910 (2053) 2053..2328 + 276 WP_279279881.1 type II toxin-antitoxin system RelE/ParE family toxin -
NFK94_RS22915 (2523) 2523..3731 - 1209 WP_279279882.1 IS91 family transposase -
NFK94_RS22920 (3712) 3712..3789 - 78 Protein_4 hypothetical protein -
NFK94_RS22925 (3772) 3772..4034 + 263 Protein_5 conjugal transfer protein TraA -
- (4344) 4344..4400 + 57 NuclAT_0 - -
- (4344) 4344..4400 + 57 NuclAT_0 - -
- (4344) 4344..4400 + 57 NuclAT_0 - -
- (4344) 4344..4400 + 57 NuclAT_0 - -
NFK94_RS22930 (4606) 4606..4809 + 204 WP_279279883.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NFK94_RS22935 (4806) 4806..5180 + 375 WP_279279884.1 PIN domain-containing protein Toxin
- (5269) 5269..5324 + 56 NuclAT_1 - -
- (5269) 5269..5324 + 56 NuclAT_1 - -
- (5269) 5269..5324 + 56 NuclAT_1 - -
- (5269) 5269..5324 + 56 NuclAT_1 - -
NFK94_RS22940 (5503) 5503..5972 + 470 Protein_8 conjugal transfer protein TrbC -
NFK94_RS22945 (6065) 6065..6933 + 869 Protein_9 IS3 family transposase -
NFK94_RS22950 (7005) 7005..7660 + 656 Protein_10 transposase -
NFK94_RS22955 (7662) 7662..8009 + 348 Protein_11 IS66 family insertion sequence element accessory protein TnpB -
NFK94_RS22960 (7999) 7999..8381 + 383 Protein_12 transposase -
NFK94_RS22965 (9028) 9028..10031 + 1004 Protein_13 IS110 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - iutA / iucD / iucC / iucB / iucA / fdeC 1..87118 87118
- inside IScluster/Tn - - 2523..13851 11328


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(2-114)

Antitoxin

Bacterial antitoxin of type II TA system, VapB

(1-44)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13946.35 Da        Isoelectric Point: 6.8603

>T248547 WP_279279884.1 NZ_CP099341:4806-5180 [Escherichia fergusonii]
MILVDTSVWVDHFKNKNDTLIQLLQSDFVLMHPMILAEIACGTPPAPRQRTLSDLDLLPKSHQATITEVLAFIENERLFG
LGCGLVDITLLASTKITPSAKIWTLDKRLSQLAKRLNLEYQPVH

Download         Length: 375 bp

Antitoxin


Download         Length: 68 a.a.        Molecular weight: 7499.58 Da        Isoelectric Point: 4.7085

>AT248547 WP_279279883.1 NZ_CP099341:4606-4809 [Escherichia fergusonii]
MRTTVTIDDVLYAQALEMADPGMDKSDIFREAVKTFIRVQAAKRLASLGGTTPDMEITPRRREDVAE

Download         Length: 204 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References