Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
| Location | 44132..44733 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP099340 | ||
| Organism | Escherichia fergusonii strain RHB44-C01 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | U9YA20 |
| Locus tag | NFK94_RS22605 | Protein ID | WP_001216045.1 |
| Coordinates | 44132..44512 (-) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | U9YQH9 |
| Locus tag | NFK94_RS22610 | Protein ID | WP_001190712.1 |
| Coordinates | 44512..44733 (-) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFK94_RS22575 (NFK94_22545) | 39270..39371 | - | 102 | Protein_39 | transcriptional regulator | - |
| NFK94_RS22580 (NFK94_22550) | 39584..41068 | - | 1485 | WP_279279864.1 | terminase | - |
| NFK94_RS22585 (NFK94_22555) | 41068..42249 | - | 1182 | WP_279279865.1 | terminase | - |
| NFK94_RS22590 (NFK94_22560) | 42336..42788 | - | 453 | WP_169711153.1 | Late promoter-activating protein | - |
| NFK94_RS22595 (NFK94_22565) | 42877..43920 | - | 1044 | WP_000648835.1 | DUF968 domain-containing protein | - |
| NFK94_RS22600 (NFK94_22570) | 43948..44127 | - | 180 | WP_000113018.1 | hypothetical protein | - |
| NFK94_RS22605 (NFK94_22575) | 44132..44512 | - | 381 | WP_001216045.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| NFK94_RS22610 (NFK94_22580) | 44512..44733 | - | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| NFK94_RS22615 (NFK94_22585) | 45119..46099 | - | 981 | WP_000019434.1 | IS5-like element ISKpn26 family transposase | - |
| NFK94_RS22620 (NFK94_22590) | 46362..47750 | + | 1389 | WP_001207923.1 | nitrate/nitrite transporter NarU | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..99935 | 99935 | |
| - | flank | IS/Tn | - | - | 45119..46099 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13588.29 Da Isoelectric Point: 5.1514
>T248545 WP_001216045.1 NZ_CP099340:c44512-44132 [Escherichia fergusonii]
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CLP7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CJB6 |