Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3514942..3515596 | Replicon | chromosome |
Accession | NZ_CP099338 | ||
Organism | Escherichia fergusonii strain RHB44-C01 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1PAM6 |
Locus tag | NFK94_RS17085 | Protein ID | WP_000244781.1 |
Coordinates | 3514942..3515349 (-) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | NFK94_RS17090 | Protein ID | WP_000354046.1 |
Coordinates | 3515330..3515596 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFK94_RS17065 (3510899) | 3510899..3512632 | - | 1734 | WP_000813234.1 | single-stranded-DNA-specific exonuclease RecJ | - |
NFK94_RS17070 (3512638) | 3512638..3513348 | - | 711 | WP_000715223.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NFK94_RS17075 (3513373) | 3513373..3514269 | - | 897 | WP_000806645.1 | site-specific tyrosine recombinase XerD | - |
NFK94_RS17080 (3514381) | 3514381..3514902 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
NFK94_RS17085 (3514942) | 3514942..3515349 | - | 408 | WP_000244781.1 | protein YgfX | Toxin |
NFK94_RS17090 (3515330) | 3515330..3515596 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
NFK94_RS17095 (3515848) | 3515848..3516828 | + | 981 | WP_000886103.1 | tRNA-modifying protein YgfZ | - |
NFK94_RS17100 (3517024) | 3517024..3517683 | - | 660 | WP_000250283.1 | hemolysin III family protein | - |
NFK94_RS17105 (3517847) | 3517847..3518158 | - | 312 | WP_001182961.1 | N(4)-acetylcytidine aminohydrolase | - |
NFK94_RS17110 (3518203) | 3518203..3519636 | + | 1434 | WP_046083325.1 | 6-phospho-beta-glucosidase BglA | - |
NFK94_RS17115 (3519684) | 3519684..3520577 | - | 894 | WP_000819362.1 | transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T248534 WP_000244781.1 NZ_CP099338:c3515349-3514942 [Escherichia fergusonii]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|