Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3238523..3239142 | Replicon | chromosome |
| Accession | NZ_CP099338 | ||
| Organism | Escherichia fergusonii strain RHB44-C01 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | NFK94_RS15610 | Protein ID | WP_001280991.1 |
| Coordinates | 3238924..3239142 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | B7LLQ9 |
| Locus tag | NFK94_RS15605 | Protein ID | WP_000344803.1 |
| Coordinates | 3238523..3238897 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFK94_RS15595 (3233655) | 3233655..3234848 | + | 1194 | WP_279279692.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| NFK94_RS15600 (3234871) | 3234871..3238020 | + | 3150 | WP_001132493.1 | efflux RND transporter permease AcrB | - |
| NFK94_RS15605 (3238523) | 3238523..3238897 | + | 375 | WP_000344803.1 | Hha toxicity modulator TomB | Antitoxin |
| NFK94_RS15610 (3238924) | 3238924..3239142 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| NFK94_RS15615 (3239639) | 3239639..3240109 | + | 471 | WP_279279846.1 | YlaC family protein | - |
| NFK94_RS15620 (3240248) | 3240248..3241798 | + | 1551 | WP_001260376.1 | EAL domain-containing protein | - |
| NFK94_RS15625 (3241840) | 3241840..3242193 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
| NFK94_RS15635 (3242572) | 3242572..3242883 | + | 312 | WP_000409911.1 | MGMT family protein | - |
| NFK94_RS15640 (3242914) | 3242914..3243486 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T248533 WP_001280991.1 NZ_CP099338:3238924-3239142 [Escherichia fergusonii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14525.33 Da Isoelectric Point: 4.8989
>AT248533 WP_000344803.1 NZ_CP099338:3238523-3238897 [Escherichia fergusonii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|