Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 748266..748816 | Replicon | chromosome |
| Accession | NZ_CP099338 | ||
| Organism | Escherichia fergusonii strain RHB44-C01 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | - |
| Locus tag | NFK94_RS03730 | Protein ID | WP_279279780.1 |
| Coordinates | 748502..748816 (+) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | V0VEX8 |
| Locus tag | NFK94_RS03725 | Protein ID | WP_000125566.1 |
| Coordinates | 748266..748499 (+) | Length | 78 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFK94_RS03700 (743338) | 743338..743625 | + | 288 | WP_000203741.1 | ferredoxin-like protein FixX | - |
| NFK94_RS03705 (743684) | 743684..745015 | + | 1332 | WP_279279779.1 | MFS transporter | - |
| NFK94_RS03710 (745123) | 745123..745653 | + | 531 | WP_000600701.1 | glutathione-regulated potassium-efflux system oxidoreductase KefF | - |
| NFK94_RS03715 (745646) | 745646..747508 | + | 1863 | WP_104919956.1 | glutathione-regulated potassium-efflux system protein KefC | - |
| NFK94_RS03720 (747701) | 747701..748180 | + | 480 | WP_000624375.1 | type 3 dihydrofolate reductase | - |
| NFK94_RS03725 (748266) | 748266..748499 | + | 234 | WP_000125566.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
| NFK94_RS03730 (748502) | 748502..748816 | + | 315 | WP_279279780.1 | CcdB family protein | Toxin |
| NFK94_RS03735 (748813) | 748813..749661 | - | 849 | WP_000257189.1 | bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH | - |
| NFK94_RS03740 (749668) | 749668..750045 | - | 378 | WP_000610901.1 | Co2+/Mg2+ efflux protein ApaG | - |
| NFK94_RS03745 (750048) | 750048..750869 | - | 822 | WP_001065388.1 | 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA | - |
| NFK94_RS03750 (750866) | 750866..751855 | - | 990 | WP_104918215.1 | 4-hydroxythreonine-4-phosphate dehydrogenase PdxA | - |
| NFK94_RS03755 (751855) | 751855..753141 | - | 1287 | WP_104919957.1 | peptidylprolyl isomerase SurA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11750.75 Da Isoelectric Point: 8.0666
>T248523 WP_279279780.1 NZ_CP099338:748502-748816 [Escherichia fergusonii]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSHIRPPERLNPILLLVDGKEYVLMTHETATVPVNTLG
TKFCDVSAHRTLIKGALDFMLDGI
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSHIRPPERLNPILLLVDGKEYVLMTHETATVPVNTLG
TKFCDVSAHRTLIKGALDFMLDGI
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|