Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 23139..23664 Replicon plasmid unnamed5
Accession NZ_CP099336
Organism Escherichia fergusonii strain RHB44-C03

Toxin (Protein)


Gene name ccdB Uniprot ID F0JY91
Locus tag NFK96_RS23660 Protein ID WP_001159869.1
Coordinates 23359..23664 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID H9TJP1
Locus tag NFK96_RS23655 Protein ID WP_000813630.1
Coordinates 23139..23357 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NFK96_RS23630 (NFK96_23590) 18827..18977 - 151 Protein_17 hypothetical protein -
NFK96_RS23635 (NFK96_23595) 18930..19160 - 231 WP_252990174.1 IS66 family insertion sequence element accessory protein TnpB -
NFK96_RS23640 (NFK96_23600) 20038..20688 + 651 Protein_19 transposase -
NFK96_RS23645 (NFK96_23605) 20966..21562 - 597 Protein_20 IS66 family transposase -
NFK96_RS23650 (NFK96_23610) 21652..22080 - 429 Protein_21 hypothetical protein -
NFK96_RS23655 (NFK96_23615) 23139..23357 + 219 WP_000813630.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
NFK96_RS23660 (NFK96_23620) 23359..23664 + 306 WP_001159869.1 type II toxin-antitoxin system toxin CcdB Toxin
NFK96_RS23665 (NFK96_23625) 23665..23865 + 201 Protein_24 phage integrase family protein -
NFK96_RS23670 (NFK96_23630) 23850..24761 - 912 WP_000549737.1 DMT family transporter -
NFK96_RS23675 (NFK96_23635) 24878..25015 + 138 Protein_26 Lrp/AsnC family transcriptional regulator -
NFK96_RS23680 (NFK96_23640) 25015..26064 + 1050 Protein_27 IS4 family transposase -
NFK96_RS23685 (NFK96_23645) 26164..27537 - 1374 WP_000244368.1 IS4-like element ISEc13 family transposase -
NFK96_RS23690 (NFK96_23650) 27749..28183 - 435 WP_000525034.1 IS200/IS605 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - - 1..46121 46121
- inside IScluster/Tn - - 17979..28183 10204


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11678.46 Da        Isoelectric Point: 6.4674

>T248520 WP_001159869.1 NZ_CP099336:23359-23664 [Escherichia fergusonii]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTSDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8354.27 Da        Isoelectric Point: 4.5203

>AT248520 WP_000813630.1 NZ_CP099336:23139-23357 [Escherichia fergusonii]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTLQNEARRLRAERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3V2SIB9

Antitoxin

Source ID Structure
AlphaFold DB A0A829CEF5

References