248519

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsxAB/Xre(antitoxin)
Location 7032..7533 Replicon plasmid unnamed4
Accession NZ_CP099335
Organism Escherichia fergusonii strain RHB44-C03

Toxin (Protein)


Gene name TsxA Uniprot ID H1ZXU8
Locus tag NFK96_RS23225 Protein ID WP_000702247.1
Coordinates 7032..7292 (+) Length 87 a.a.

Antitoxin (Protein)


Gene name TsxB Uniprot ID -
Locus tag NFK96_RS23230 Protein ID WP_001132407.1
Coordinates 7282..7533 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NFK96_RS23180 (NFK96_23135) 2570..2722 + 153 Protein_2 DUF5431 family protein -
NFK96_RS23185 (NFK96_23140) 2667..2789 + 123 WP_223170659.1 type I toxin-antitoxin system Hok family toxin -
NFK96_RS23190 (NFK96_23145) 2939..3535 + 597 WP_000125165.1 ProQ/FINO family protein -
NFK96_RS23195 (NFK96_23150) 3553..3837 - 285 WP_001162371.1 hypothetical protein -
NFK96_RS23200 (NFK96_23155) 3911..4576 - 666 WP_000532148.1 division plane positioning ATPase MipZ -
NFK96_RS23205 (NFK96_23160) 5174..5503 + 330 WP_000855120.1 hypothetical protein -
NFK96_RS23210 (NFK96_23165) 6085..6408 + 324 WP_000427403.1 hypothetical protein -
NFK96_RS23215 (NFK96_23170) 6450..6659 + 210 WP_000866036.1 hypothetical protein -
NFK96_RS23220 (NFK96_23175) 6756..6980 + 225 WP_000814381.1 hypothetical protein -
NFK96_RS23225 (NFK96_23180) 7032..7292 + 261 WP_000702247.1 hypothetical protein Toxin
NFK96_RS23230 (NFK96_23185) 7282..7533 + 252 WP_001132407.1 transcriptional regulator Antitoxin
NFK96_RS23235 (NFK96_23190) 8084..8362 + 279 WP_000545938.1 hypothetical protein -
NFK96_RS23240 (NFK96_23195) 8782..9048 + 267 WP_000681608.1 type II toxin-antitoxin system HicB family antitoxin -
NFK96_RS23245 (NFK96_23200) 9155..9598 - 444 WP_000068545.1 hypothetical protein -
NFK96_RS23250 (NFK96_23205) 9895..10077 + 183 WP_000833470.1 type II toxin-antitoxin system HicA family toxin -
NFK96_RS23255 (NFK96_23210) 10102..10539 + 438 WP_000466318.1 type II toxin-antitoxin system HicB family antitoxin -
NFK96_RS23260 (NFK96_23215) 10670..10996 - 327 WP_000206701.1 hypothetical protein -
NFK96_RS23265 (NFK96_23220) 11016..11615 - 600 WP_000091423.1 hypothetical protein -
NFK96_RS23270 (NFK96_23225) 11662..12363 - 702 WP_000280995.1 StbB family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - - 1..59932 59932


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Cro/C1-type helix-turn-helix domain

(8-37)


Sequences

Toxin        


Download         Length: 87 a.a.        Molecular weight: 9817.29 Da        Isoelectric Point: 10.0665

>T248519 WP_000702247.1 NZ_CP099335:7032-7292 [Escherichia fergusonii]
MKIRKGDRQYYLNKEGDTFHLVKRVKTFSKSATLGKTKATVKTVADLVFHEKAFDTIDFASDGLRENDKEIVSMMIQEMS
EGKNAK

Download         Length: 261 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9404.77 Da        Isoelectric Point: 9.8120

>AT248519 WP_001132407.1 NZ_CP099335:7282-7533 [Escherichia fergusonii]
MPNENTPENIKRLRQKIGLTQKECAEIFSMSPRTWRRKEEPVGTASGTALTPVEFKFLLLLAGEHPDYVLCKRNKKNSDS
GSN

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1P8DNC0

Antitoxin

Source ID Structure

References