Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
Location | 2948..3549 | Replicon | plasmid unnamed3 |
Accession | NZ_CP099334 | ||
Organism | Escherichia fergusonii strain RHB44-C03 |
Toxin (Protein)
Gene name | doc | Uniprot ID | F0JYA5 |
Locus tag | NFK96_RS22740 | Protein ID | WP_001216044.1 |
Coordinates | 2948..3328 (-) | Length | 127 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | U9YQH9 |
Locus tag | NFK96_RS22745 | Protein ID | WP_001190712.1 |
Coordinates | 3328..3549 (-) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFK96_RS22725 (NFK96_22680) | 1152..1604 | - | 453 | WP_001312282.1 | late promoter-activating protein (Gp10) | - |
NFK96_RS22730 (NFK96_22685) | 1693..2736 | - | 1044 | WP_000648835.1 | DUF968 domain-containing protein | - |
NFK96_RS22735 (NFK96_22690) | 2764..2943 | - | 180 | WP_000113018.1 | hypothetical protein | - |
NFK96_RS22740 (NFK96_22695) | 2948..3328 | - | 381 | WP_001216044.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
NFK96_RS22745 (NFK96_22700) | 3328..3549 | - | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NFK96_RS22750 (NFK96_22705) | 3935..4915 | - | 981 | WP_279284741.1 | IS5-like element ISKpn26 family transposase | - |
NFK96_RS22755 (NFK96_22710) | 5178..6566 | + | 1389 | WP_001207923.1 | nitrate/nitrite transporter NarU | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..89104 | 89104 | |
- | flank | IS/Tn | - | - | 3935..4915 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13544.28 Da Isoelectric Point: 5.6343
>T248518 WP_001216044.1 NZ_CP099334:c3328-2948 [Escherichia fergusonii]
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVAATLRRLYGSAE
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVAATLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6Y6HMN5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CJB6 |