Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 27301..27944 | Replicon | plasmid unnamed2 |
Accession | NZ_CP099333 | ||
Organism | Escherichia fergusonii strain RHB44-C03 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | B1LRW4 |
Locus tag | NFK96_RS22345 | Protein ID | WP_001044768.1 |
Coordinates | 27301..27717 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | D2WFK3 |
Locus tag | NFK96_RS22350 | Protein ID | WP_001261287.1 |
Coordinates | 27714..27944 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFK96_RS22330 (NFK96_22285) | 23800..24390 | - | 591 | WP_000194575.1 | hypothetical protein | - |
NFK96_RS22335 (NFK96_22290) | 24390..24647 | - | 258 | WP_000343085.1 | hypothetical protein | - |
NFK96_RS22340 (NFK96_22295) | 25001..27139 | + | 2139 | WP_000350638.1 | AAA family ATPase | - |
NFK96_RS22345 (NFK96_22300) | 27301..27717 | - | 417 | WP_001044768.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NFK96_RS22350 (NFK96_22305) | 27714..27944 | - | 231 | WP_001261287.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
NFK96_RS22355 (NFK96_22310) | 28240..28530 | + | 291 | WP_000111771.1 | hypothetical protein | - |
NFK96_RS22360 (NFK96_22315) | 28520..29419 | + | 900 | WP_000963206.1 | nucleotide-binding protein | - |
NFK96_RS22365 (NFK96_22320) | 29469..31694 | - | 2226 | WP_000698737.1 | P-loop NTPase fold protein | - |
NFK96_RS22370 (NFK96_22325) | 31696..32784 | - | 1089 | WP_000952217.1 | transcriptional repressor PifC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | sitABCD | - | 1..90815 | 90815 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15197.66 Da Isoelectric Point: 7.7805
>T248517 WP_001044768.1 NZ_CP099333:c27717-27301 [Escherichia fergusonii]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A606Q844 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QFC4 |