Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3493889..3494543 | Replicon | chromosome |
Accession | NZ_CP099331 | ||
Organism | Escherichia fergusonii strain RHB44-C03 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | F0JPE9 |
Locus tag | NFK96_RS16760 | Protein ID | WP_000244774.1 |
Coordinates | 3493889..3494296 (-) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | NFK96_RS16765 | Protein ID | WP_000354046.1 |
Coordinates | 3494277..3494543 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFK96_RS16740 (3489846) | 3489846..3491579 | - | 1734 | WP_223684717.1 | single-stranded-DNA-specific exonuclease RecJ | - |
NFK96_RS16745 (3491585) | 3491585..3492295 | - | 711 | WP_000715223.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NFK96_RS16750 (3492320) | 3492320..3493216 | - | 897 | WP_196233981.1 | site-specific tyrosine recombinase XerD | - |
NFK96_RS16755 (3493328) | 3493328..3493849 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
NFK96_RS16760 (3493889) | 3493889..3494296 | - | 408 | WP_000244774.1 | protein YgfX | Toxin |
NFK96_RS16765 (3494277) | 3494277..3494543 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
NFK96_RS16770 (3494795) | 3494795..3495775 | + | 981 | WP_223684718.1 | tRNA-modifying protein YgfZ | - |
NFK96_RS16775 (3495852) | 3495852..3496511 | - | 660 | WP_000250283.1 | hemolysin III family protein | - |
NFK96_RS16780 (3496675) | 3496675..3496986 | - | 312 | WP_181590787.1 | N(4)-acetylcytidine aminohydrolase | - |
NFK96_RS16785 (3497031) | 3497031..3498464 | + | 1434 | WP_279284606.1 | 6-phospho-beta-glucosidase BglA | - |
NFK96_RS16790 (3498512) | 3498512..3499405 | - | 894 | WP_000819362.1 | transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16078.05 Da Isoelectric Point: 11.2511
>T248499 WP_000244774.1 NZ_CP099331:c3494296-3493889 [Escherichia fergusonii]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWCIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWCIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0L6ZX35 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6B58 | |
PDB | 1X6I | |
PDB | 1X6J | |
PDB | 6C12 | |
AlphaFold DB | A0A7U9QD57 |