Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
Location | 3857834..3858410 | Replicon | chromosome |
Accession | NZ_CP099328 | ||
Organism | Escherichia fergusonii strain RHB44-C21 |
Toxin (Protein)
Gene name | shpA | Uniprot ID | A0A7W3EF74 |
Locus tag | NFL02_RS18500 | Protein ID | WP_024256534.1 |
Coordinates | 3858123..3858410 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | shpB | Uniprot ID | A0A829G8Z0 |
Locus tag | NFL02_RS18495 | Protein ID | WP_000063156.1 |
Coordinates | 3857834..3858136 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFL02_RS18475 (3853648) | 3853648..3854160 | + | 513 | WP_279283988.1 | 4-hydroxyphenylacetate 3-monooxygenase reductase subunit | - |
NFL02_RS18480 (3854430) | 3854430..3856580 | + | 2151 | WP_001314407.1 | pyruvate/proton symporter BtsT | - |
NFL02_RS18485 (3856630) | 3856630..3856833 | + | 204 | WP_000467859.1 | YbdD/YjiX family protein | - |
NFL02_RS18490 (3856844) | 3856844..3857800 | + | 957 | WP_001297640.1 | GTPase | - |
NFL02_RS18495 (3857834) | 3857834..3858136 | - | 303 | WP_000063156.1 | BrnA antitoxin family protein | Antitoxin |
NFL02_RS18500 (3858123) | 3858123..3858410 | - | 288 | WP_024256534.1 | BrnT family toxin | Toxin |
NFL02_RS18505 (3858566) | 3858566..3859300 | - | 735 | WP_279283989.1 | Fic family protein | - |
NFL02_RS18510 (3859563) | 3859563..3863075 | + | 3513 | WP_279283990.1 | type I restriction-modification system endonuclease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11241.74 Da Isoelectric Point: 7.4020
>T248477 WP_024256534.1 NZ_CP099328:c3858410-3858123 [Escherichia fergusonii]
MPMEFEWDANKAKSNRMKHGIRFEDAVLVFDDPQHLSQQDRIENGEYRWQTIGLVYGIVVILVAHTIRFESGNEIIRIIS
ARKADRKERNRYEHG
MPMEFEWDANKAKSNRMKHGIRFEDAVLVFDDPQHLSQQDRIENGEYRWQTIGLVYGIVVILVAHTIRFESGNEIIRIIS
ARKADRKERNRYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7W3EF74 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829G8Z0 |