Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3679566..3680364 Replicon chromosome
Accession NZ_CP099328
Organism Escherichia fergusonii strain RHB44-C21

Toxin (Protein)


Gene name yeeV Uniprot ID U9XMP3
Locus tag NFL02_RS17645 Protein ID WP_000854735.1
Coordinates 3679987..3680364 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A067H947
Locus tag NFL02_RS17640 Protein ID WP_001285415.1
Coordinates 3679566..3679940 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NFL02_RS17605 (3675497) 3675497..3676177 + 681 WP_001282919.1 WYL domain-containing protein -
NFL02_RS17610 (3676325) 3676325..3677002 + 678 WP_001097301.1 hypothetical protein -
NFL02_RS17615 (3677008) 3677008..3677241 + 234 WP_001278287.1 DUF905 family protein -
NFL02_RS17620 (3677331) 3677331..3678149 + 819 WP_001175148.1 DUF932 domain-containing protein -
NFL02_RS17625 (3678231) 3678231..3678710 + 480 WP_000844100.1 antirestriction protein -
NFL02_RS17630 (3678726) 3678726..3679202 + 477 WP_001366855.1 RadC family protein -
NFL02_RS17635 (3679265) 3679265..3679486 + 222 WP_000692309.1 DUF987 domain-containing protein -
NFL02_RS17640 (3679566) 3679566..3679940 + 375 WP_001285415.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
NFL02_RS17645 (3679987) 3679987..3680364 + 378 WP_000854735.1 TA system toxin CbtA family protein Toxin
NFL02_RS17650 (3680361) 3680361..3680849 + 489 WP_000761676.1 DUF5983 family protein -
NFL02_RS17655 (3680861) 3680861..3681058 + 198 WP_000839291.1 DUF957 domain-containing protein -
NFL02_RS17660 (3681143) 3681143..3682009 + 867 WP_001280433.1 DUF4942 domain-containing protein -
NFL02_RS17665 (3682081) 3682081..3682344 + 264 WP_001143297.1 type II toxin-antitoxin system ParD family antitoxin -
NFL02_RS17670 (3682341) 3682341..3682667 + 327 WP_000779483.1 type II toxin-antitoxin system RelE/ParE family toxin -
NFL02_RS17675 (3683170) 3683170..3683280 + 111 WP_229321778.1 Arm DNA-binding domain-containing protein -
NFL02_RS17680 (3683375) 3683375..3683455 - 81 Protein_3445 GNAT family N-acetyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14061.07 Da        Isoelectric Point: 8.2904

>T248476 WP_000854735.1 NZ_CP099328:3679987-3680364 [Escherichia fergusonii]
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 13663.32 Da        Isoelectric Point: 5.8640

>AT248476 WP_001285415.1 NZ_CP099328:3679566-3679940 [Escherichia fergusonii]
VSDTHPGTTHPDNNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9XMP3

Antitoxin

Source ID Structure
AlphaFold DB A0A067H947

References