Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 3535807..3536461 | Replicon | chromosome |
| Accession | NZ_CP099328 | ||
| Organism | Escherichia fergusonii strain RHB44-C21 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1PAM6 |
| Locus tag | NFL02_RS17000 | Protein ID | WP_000244781.1 |
| Coordinates | 3535807..3536214 (-) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | NFL02_RS17005 | Protein ID | WP_000354046.1 |
| Coordinates | 3536195..3536461 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFL02_RS16980 (3531764) | 3531764..3533497 | - | 1734 | WP_000813234.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| NFL02_RS16985 (3533503) | 3533503..3534213 | - | 711 | WP_046076902.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| NFL02_RS16990 (3534238) | 3534238..3535134 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| NFL02_RS16995 (3535246) | 3535246..3535767 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
| NFL02_RS17000 (3535807) | 3535807..3536214 | - | 408 | WP_000244781.1 | protein YgfX | Toxin |
| NFL02_RS17005 (3536195) | 3536195..3536461 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| NFL02_RS17010 (3536713) | 3536713..3537693 | + | 981 | WP_181590786.1 | tRNA-modifying protein YgfZ | - |
| NFL02_RS17015 (3537770) | 3537770..3538429 | - | 660 | WP_000250283.1 | hemolysin III family protein | - |
| NFL02_RS17020 (3538593) | 3538593..3538904 | - | 312 | WP_181590787.1 | N(4)-acetylcytidine aminohydrolase | - |
| NFL02_RS17025 (3538949) | 3538949..3540382 | + | 1434 | WP_024256637.1 | 6-phospho-beta-glucosidase BglA | - |
| NFL02_RS17030 (3540430) | 3540430..3541323 | - | 894 | WP_000819362.1 | transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T248475 WP_000244781.1 NZ_CP099328:c3536214-3535807 [Escherichia fergusonii]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|